SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001527 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001527
Domain Number 1 Region: 13-182
Classification Level Classification E-value
Superfamily EF-hand 5.45e-41
Family Calmodulin-like 0.000000392
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001527   Gene: ENSTGUG00000001480   Transcript: ENSTGUT00000001540
Sequence length 198
Comment pep:known_by_projection chromosome:taeGut3.2.4:26:3257430:3260478:-1 gene:ENSTGUG00000001480 transcript:ENSTGUT00000001540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQQFTNAEGEQGEIDVAELQEWYKKFVVECPSGTLFMHEFKRFFGVQDNQEAAEYVENM
FRAFDKNGDNTIDFLEYVAALNLVLRGKLEHKLRWTFKVYDKDGNGCIDKPELLEIVESI
YRLKKVCWSEVEDRTPLLTPEEVVDRIFQLVDENGDGQLSLDEFIDGARKDKWVMKMLQM
DVNPGGWITEQRRKSALF
Download sequence
Identical sequences H0YTB4
ENSTGUP00000001527 XP_002198650.1.42559 59729.ENSTGUP00000001527 ENSTGUP00000001527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]