SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001547 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001547
Domain Number 1 Region: 461-583
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-30
Family Cadherin 0.0014
Further Details:      
 
Domain Number 2 Region: 242-367
Classification Level Classification E-value
Superfamily Cadherin-like 6.41e-28
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 139-246
Classification Level Classification E-value
Superfamily Cadherin-like 3e-23
Family Cadherin 0.0035
Further Details:      
 
Domain Number 4 Region: 355-465
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-20
Family Cadherin 0.0075
Further Details:      
 
Domain Number 5 Region: 577-684
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000118
Family Cadherin 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000001547
Domain Number - Region: 38-137
Classification Level Classification E-value
Superfamily Cadherin-like 0.00179
Family Cadherin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001547   Gene: ENSTGUG00000001502   Transcript: ENSTGUT00000001561
Sequence length 1142
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:120206:128447:-1 gene:ENSTGUG00000001502 transcript:ENSTGUT00000001561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EINCKNLQMYRIDGKMHFVFGFALILISCNNAVLGKNLKYRIYEEQRVGSVIARLSEDVA
DVLLKMPNPSSVRFRAMQRGNSPLLVVREDNGEISIGAKIDREQLCQKNLNCSIEFDVIT
LPTEHLQLFHVEVEVLDINDNSPQFSRALIPIEISESAAVGTRIPLDSAFDPDVGDNSLH
TYSLSANDFFSIDVRTRTDGAKYAELIVVRELDRELKSTYELQLTASDKGVPQRSGSSLL
KISISDSNDNSPVFEQQSYIIQLLENSPVGTLLIDLNATDPDEGANGKVVYSFSSHVSAK
IIETFRIDPEKGHLTLLKQVDYELTKSYEIDAQAQDMGPNSIPAHCKIIIKVVDVNDNKP
EINLNLMSTEREEVACISEGSPLDTFVALVRVQDKDSGVNGEVVCKLHGHGHFKLQKTYE
NNYLILTNATLDREKRSEYILTVIAEDKGTPSLSTVKHFTVQISDENDNPPRFQTNRYEV
VILENNSPGAYITSVTATDPDLGDNGQVTYTILENSVLGSSITTYVTIDPSNGAIYALRT
FDHEEVNQIAFTVQARDGGSQQLISNTTVVLTIIDENDNAPVIVGPALRNSTAEISIPKD
AEIGFLVTRIRATDRDSGMNSELSCSIAADKENSIFVMDPQTCDISINVSVESVPAKQWE
FLVIVQDKGSPQLSTKALLKCTILEHVYSFSSTEATLVSQPSLDISMITIISLGSICAVL
LVIMVIFATRCNREKKDTRSYNCRVAESTYQHHPKRPSRQIHKGDITLVPTVNGTLPIRS
HHRASPSSSPALERGQMSSRQSHHSHQSLNSLVTISSNHMPENFSLELTHATPAVEVSQL
LSMLHQGQYQPRPSFRGNKYSRSYRYALQDMDKFSLKDSGRGDSEAGDSDYDLGRESPID
RLLGEGFSDLFLTDGRIPAAMRLCTEECRVLGHSDQCWMPPLPSPSSDYRSNMFIPGEEF
QSPQQHLQQQHHQGLEEDAQAADAGEKKKSFSTFGKDCQSEEESGDTCTSSLLSEMSSVF
QRLLPPSLDAYAECSETDRSNSLERRKGHLPAKNVNYPPGVAAWAASTHFQNPANNGPAL
GTHSGAQPSSKWLPAMEEIPENYEEDDFDNVLNHLSDGKHELMDASELVAEINKLLQDVR
QN
Download sequence
Identical sequences H0YTD4
59729.ENSTGUP00000001547 ENSTGUP00000001547 ENSTGUP00000001547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]