SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001548 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001548
Domain Number 1 Region: 575-898
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.4e-52
Family Diacylglycerol kinase-like 0.011
Further Details:      
 
Domain Number 2 Region: 48-98
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000404
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0058
Further Details:      
 
Domain Number 3 Region: 164-227
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000068
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0024
Further Details:      
 
Domain Number 4 Region: 382-463
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000176
Family Ras-binding domain, RBD 0.016
Further Details:      
 
Domain Number 5 Region: 107-158
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000174
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.027
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000001548
Domain Number - Region: 287-339
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00336
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001548   Gene: ENSTGUG00000001497   Transcript: ENSTGUT00000001562
Sequence length 910
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:31755616:31985492:-1 gene:ENSTGUG00000001497 transcript:ENSTGUT00000001562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSVPKGVKVLNNSKAQLYGDPTQQPVQRSKSQGSSTSSRSSSGGSSPPGHTFRRVTLTKP
TFCHYCTDFIWGLAGYQCEVCNFMSHEKCLKNVKIPCSCIAPSLVRVPVAHCFGPPGHYK
RKFCAVCRKSLESPAFRCEVCELHVHTDCILFACSDCRQCHQDGHLDHDTYHHHWREGNL
SSSARCEFCKKTCGSSEVLSGMRCEWCGILAHAACCVIVPPECTFGRLRNMILPPNCVQL
FSRNFSKLHCFRISENLQTDSDEDDDVDGSTQGSTKDIQISTDSSKQTLKIFDGNDAVKR
NQFRLISVPRIAKNEEVVEAALRAYYINDDQQEYELQTFTQQVLLSDDVINRNDAAEDSN
LGSVFRESVPEAWIIRAKPKDEEVIRIYPAWLKVGMAYVSLRVNKDSTVQTAIKEVLPLL
GRQMECLQNFKLVEVLMGSKQVQRMVLDSQELILNRLKDIRKQTSIRQMNQTRFYIVENS
KSIVQVNVFVGGLPPQLSPEEYTNILKEELAIKTNVVSVSHVYQAQGAVVLQISCFSEAE
RIYMLVKDTVVNDKPLNAVVIPAVMASKIPQNCCPLLVFVNPKSGGLKGRDLLYSFRKLL
NPHQVFELTNGGPLPGFHTFSKVPSFRVLVCGGDGTVGWVLGALEEIRHKLVCSEPSVAI
LPLGTGNDLGRVLRWGAGYSGEDPYSILVSVDEADDVLMDRWTILLDAEEPAEGAENGIA
EPEPPKIVQMNNYCGLGIDAELSLDFHHAREEEPGKFNSRFHNKGVYVKVGLQKISHTRN
LHKDIKLQVDQHEVELPSIEGLIFINIPSWGSGADLWGSESDNRFEKPRIDDGLLEVVGV
TGVVHMGQVQGGFRSGIRIAQGSYFRVTLLKPIPVQVDGEPWIQAPGQIIISAAGPKVHM
LKKSKQKQKK
Download sequence
Identical sequences H0YTD5
ENSTGUP00000001548 59729.ENSTGUP00000001548 ENSTGUP00000001548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]