SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001570 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001570
Domain Number 1 Region: 319-477,556-687
Classification Level Classification E-value
Superfamily L domain-like 1.48e-54
Family Ngr ectodomain-like 0.00084
Further Details:      
 
Domain Number 2 Region: 92-299
Classification Level Classification E-value
Superfamily L domain-like 6.38e-42
Family Ngr ectodomain-like 0.00022
Further Details:      
 
Domain Number 3 Region: 956-1146
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.6e-40
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 798-925
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000596
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 5 Region: 2-60
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000605
Family Ngr ectodomain-like 0.006
Further Details:      
 
Domain Number 6 Region: 769-809
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000161
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 727-768
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000168
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 8 Region: 1184-1220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000816
Family EGF-type module 0.033
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000001570
Domain Number - Region: 1148-1180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00117
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 1222-1259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00205
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001570   Gene: ENSTGUG00000001512   Transcript: ENSTGUT00000001584
Sequence length 1337
Comment pep:known_by_projection chromosome:taeGut3.2.4:13:14828613:15022696:-1 gene:ENSTGUG00000001512 transcript:ENSTGUT00000001584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLNNNNITRIPVTSFNHMPKIRTLRLHSNFLHCDCHLAWLSDWLRQRRTIGQFTFCLAPV
GLRGFLVAEVQKKDFVCSGSPSEPPSCSASSITCPSACTCSNNVVDCRGRGLTEIPANLP
EDIWEIRLEQNLIKIIPPGAFTQYKKLKRIDISKNQITDIAPDAFKGLKSLISLVLYGNK
ITEIPQGLFDDLVSLQLLLLNANKINCLRVNTFQGLHNLKLLSLYDNKLQTVSKGLFAPL
RSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSNPRRLANKRISQIKSKKFRCS
GSEDYRSKFTGKCFMDLVCPEKCRCEGTVVDCSNQKLARLPTHLPEYTTDLRLNDNDISV
LEAVGLFKKLPNLRKINLSNNKIKEIREGAFDGASGVQELILTENQLESVHGRMFRGLTG
LKTLMLRSNSISCINNDTFAGLSSVRLLSLYDNHISTITPGAFSTLVSLSTINLLANSFN
CNCHLAWLGKWLRKKRIVSGNPRCLKPFFLKDIPIQDVDVQDFTCDGNDESSCLLSPPCP
SQCTCVDSVVRCSNKGLRMLPKGIPKDVTELYLEGNHLPAVPKGLSAFRHLTLIDLSNNS
ISVLANHTFSNMTQLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDL
VSLSHLALGTNPLHCDCHLRWLSEWVKAGYKEPGIARCRGPEAMVDRLLLTTPSHHFQCK
EPVDLSVVSKCNPCLSSPCKNNGTCSSDPVELYQCTCPFGFKGRDCSVPINSCIQNPCQN
GGTCHLTEENKDGFSCSCLLGYEGERCEINPDDCEDNDCENNSTCVDGINNYVCLCPPNY
TGELCDEVINHCVPDLNPCQHESKCVPLDKGTRCECLPGYSGKHCEVDDDDCVGHKCRHG
AACVDAVNGYTCVCPQGFSGLLCETPPPMVLLQTSPCDNYECQHGAQCIVAQHEPVCRCL
AGFAGQRCEKLITVNFVGKDSYVELPSAKIRPQANISLQVATDKDNGILLYKGDNDPLAL
ELYQGHVRLIYDTLNSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLGKLQ
KQSSVSLNTPLYIGGIPTSTGLSSLRQGADKTPNGFHGCIHDVRINNELQDFKDLPQQSL
GVLPGCKSCNICKHGICRSLEKTSVICECHPGWTGPLCDQEIGDPCLNHKCLHGKCTAAG
AAYTCKCMEGYTGVYCDKKNNSSNPCRTLKCSHGQCKVSEQGEPYCECDPGYSGELCDRE
NLCQGDIIREVVRKQQGYTSCATASKVPRLECRGSCGGGQCCVPLRSKRRKYFFQCVDGS
TFTEELERHVECGCSKC
Download sequence
Identical sequences H0YTF7
59729.ENSTGUP00000001570 ENSTGUP00000001570 ENSTGUP00000001570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]