SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001574 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001574
Domain Number 1 Region: 1-171
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.23e-70
Family Ephrin receptor ligand binding domain 0.00000156
Further Details:      
 
Domain Number 2 Region: 595-891
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.03e-62
Family Protein kinases, catalytic subunit 0.0000000393
Further Details:      
 
Domain Number 3 Region: 299-505
Classification Level Classification E-value
Superfamily Fibronectin type III 2e-30
Family Fibronectin type III 0.00019
Further Details:      
 
Domain Number 4 Region: 889-963
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.3e-18
Family SAM (sterile alpha motif) domain 0.00067
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000001574
Domain Number - Region: 227-296
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00161
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001574   Gene: ENSTGUG00000001509   Transcript: ENSTGUT00000001588
Sequence length 965
Comment pep:known_by_projection chromosome:taeGut3.2.4:23:4734790:4759609:1 gene:ENSTGUG00000001509 transcript:ENSTGUT00000001588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVLLDSKESQAELGWTSHPSNGWEEISGVDETYRPIRTYQVCNVMEPNQNNWLQTGWIAR
RDGQRIFIELKFTLRDCNSIPGVTSTCKETFNLYYVESDSDLGRSVRESRHTKIDTIAAD
ESFTQGDLGERKMKLNTELREIGHLSKRGFHLGFQDVGACVALVSVRVYYKKCLSTVQNL
AMFPDTVAETAFVTLVEVKGTCVAHAEVDVDNPPRMHCSAEGEWLVPIGKCMCSPGFEEK
DGGCRACLPGFYKLSLRLPLCSPCPEHSFTHEEASTFCLCQTNYSRSPSDPPSASCTRPP
SAPRDLVYSLRQSSLVLQWSAPADAGGRSDLTYSLWCGRCPAVPAGRCQHCGSSVGFVPQ
QTGLVERTVTLVNLLPHVNYTIRVLALNGVSALSPLAGQQYAEVTVSTGHTVPTPVTDIR
TDKVEQKSVSLSWQEPGFLTANGTEYEVKYFEKDQRDQSYSTVKTTSTAVTVNNLKPGTL
YIFQIRTSSSPDYGNYNPGIEVETLAECKSKGHCLTVASREQKPVLIIAVVATVGLTVLV
SVLVSVVVWRRQCGYSKASQDGDEELYFHFKIPTRRTYIDPSTCEDPMQAVHLFAKELDN
ANIKIERIIRTGNFFGELCRGCLKLPSKRELPVAIQTLRAGCSEKQQRSFLAEACTMGQF
DHSNVIRLEGVITRGSTMMIVMEYMGNGLLDSFLRKHEGQLTGTQLICMLQGIASGMAYL
AEMGYVHKSLAAHKVLVSSSLACKITGFRRPQEDKMETIFSTMRGKSLVLWSAPEAVQYH
HFSPASDVWSFGIVMWEVMSYGERPYWDMSHQDVMKAVEDGFRLPAPANCQPPLHQLMLS
CWQKERSQRPKFSQIHNALSKLLQSLEPPECPSSTCPRFPHLPRAFSAFPSFSSVAEWLE
AIEMGRYKDNFTAAGYCCLESVARMTAQDILSLGITLAEHQETLLSGIQSLRAQVIRMHG
RGVQV
Download sequence
Identical sequences H0YTG1
ENSTGUP00000001574 ENSTGUP00000001574 59729.ENSTGUP00000001574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]