SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001588 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001588
Domain Number 1 Region: 38-143
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.02e-16
Family Growth factor receptor domain 0.0024
Further Details:      
 
Domain Number 2 Region: 147-201
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000116
Family TSP-1 type 1 repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001588   Gene: ENSTGUG00000001536   Transcript: ENSTGUT00000001602
Sequence length 258
Comment pep:known_by_projection chromosome:taeGut3.2.4:23:4839140:4843353:1 gene:ENSTGUG00000001536 transcript:ENSTGUT00000001602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLGLLVVVVFLSSMDLTGSSKVVKGKRQRRISTELSQGCARGCDLCSEFNGCLRCSPKL
FILLERNDIRQIGICLPSCPLGYFGLRNTDMNKCIKCKIENCESCFSRNFCTKCKEGLYL
HKGRCYVTCPEGYAAANGTMECSSPAQCEMSEWGPWGPCSKKRKLCGFKKGNEDRTRRIL
QAPSGDVSLCPATTEVRRCTVQKSQCPEGKRKKKEEQGKQDNGNRNRKDTKDTKSGTKKR
KNKQRGATVPATPASPAQ
Download sequence
Identical sequences H0YTH5
59729.ENSTGUP00000001588 XP_002198269.1.42559 ENSTGUP00000001588 ENSTGUP00000001588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]