SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001596 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001596
Domain Number 1 Region: 23-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000067
Family EGF-type module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001596   Gene: ENSTGUG00000001550   Transcript: ENSTGUT00000001610
Sequence length 118
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:1190482:1202299:1 gene:ENSTGUG00000001550 transcript:ENSTGUT00000001610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENCTTALIQTENSPRVAQVGITRCKPEMKDYCFHGQCVYIVDLDEHYCRCDVGFSGVRC
VHSELVRQPLSKEYVALTVIVVLLFLAALSLASYYICRRYRNKRRQTNASEYKEVGAL
Download sequence
Identical sequences A0A218UR28 H0YTI3
59729.ENSTGUP00000001596 XP_012428707.1.42559 XP_012428708.1.42559 ENSTGUP00000001596 ENSTGUP00000001596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]