SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001611 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000001611
Domain Number - Region: 43-116
Classification Level Classification E-value
Superfamily Cadherin-like 0.000534
Family Dystroglycan, N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001611   Gene: ENSTGUG00000001558   Transcript: ENSTGUT00000001625
Sequence length 400
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:26014915:26032839:-1 gene:ENSTGUG00000001558 transcript:ENSTGUT00000001625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YTILSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPITFNTNLMGYPDR
PGWLRYIQRTPYSDGVLYGSPTVENVGKPTIIEITAYNRRTFETARHNLIINIMSAEDFP
LPYQAEFFIRNMNVEEMLASEVLGDFLGAVKNVWQPERLNAINITSALDRGGRVPLPIND
MKEGVYVMVGADVPFSSCLREVENPQNQLRCSQEMEPVITCDKKFRTQFHIDWCKISLVD
NTKQVSTFQEVIRGEGILPDGGEYKPPSDTLKSRDYYSDFLITLAVPSAIALVLFLILAY
IMCCRREGVEKRNMQTPDIQLVHHSAIQKSTKELRDMSKNREIAWPLSTLPVFHPVTGEI
VPALHTDSYDNTSMPLMQTQQNLPHQTQIPQQQSAGKWYS
Download sequence
Identical sequences H0YTJ8
59729.ENSTGUP00000001611 ENSTGUP00000001611 ENSTGUP00000001611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]