SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001661 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001661
Domain Number 1 Region: 9-32
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 0.000034
Family Beta-D-glucan exohydrolase, C-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001661   Gene: ENSTGUG00000001613   Transcript: ENSTGUT00000001675
Sequence length 161
Comment pep:novel chromosome:taeGut3.2.4:23:5352300:5352899:-1 gene:ENSTGUG00000001613 transcript:ENSTGUT00000001675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENYTMEGRTYRYYGQEAPLYPFGYGLSYTTFRYRDLVLSPPVLPLCANLSVSVVLENTG
LRDSEEVVQLYLRWEHSSVPVPRWQLVAFRRVAVPAGREAKLSFQVLAEQRAVWAQHWHL
EPGTFTLFAGGQQPGQKRRVPSEVLSARFSVTGTARPLRTC
Download sequence
Identical sequences H0YTP8
ENSTGUP00000001661 59729.ENSTGUP00000001661 ENSTGUP00000001661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]