SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001663 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001663
Domain Number 1 Region: 102-225
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 0.0000000000000196
Family Beta-D-glucan exohydrolase, C-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 4-101
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000000000179
Family NagZ-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001663   Gene: ENSTGUG00000001614   Transcript: ENSTGUT00000001677
Sequence length 228
Comment pep:novel chromosome:taeGut3.2.4:23:5353369:5354700:-1 gene:ENSTGUG00000001614 transcript:ENSTGUT00000001677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGHHYTRSFLETAVASVNAGCNLELSYGMRNNVFMRIPEALAMGNITLQMLRDRVRPLF
YTRMRLGEFDPPAMNPYSSLDLSVVQSPEHRNLSLEAAVKSFVLLKNVRGTLPLKAQDLS
SQHLAVVGPFADNPRVLFGDYAPVPEPRYIYTPRRGLEMLGANVSFAAGCSEPRCQRYSR
AELVKVVGAADVVLVCLGTGVDVETEAKDRSDLSLPGHQLELLQDAVQ
Download sequence
Identical sequences H0YTQ0
59729.ENSTGUP00000001663 ENSTGUP00000001663 ENSTGUP00000001663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]