SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001737 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001737
Domain Number 1 Region: 280-408
Classification Level Classification E-value
Superfamily PH domain-like 3.57e-30
Family Phosphotyrosine-binding domain (PTB) 0.0000644
Further Details:      
 
Domain Number 2 Region: 108-259
Classification Level Classification E-value
Superfamily PH domain-like 7.01e-29
Family Phosphotyrosine-binding domain (PTB) 0.015
Further Details:      
 
Domain Number 3 Region: 25-65
Classification Level Classification E-value
Superfamily WW domain 0.000000000105
Family WW domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001737   Gene: ENSTGUG00000001677   Transcript: ENSTGUT00000001753
Sequence length 409
Comment pep:known_by_projection chromosome:taeGut3.2.4:13:16504216:16508010:-1 gene:ENSTGUG00000001677 transcript:ENSTGUT00000001753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAGGGAMLGKDYMLAVLFNCDDNLWSDQSLETDPDLPPGWRKICDSLGTYYWHVPTGTTQ
WQHPARSTGPGGHTDADGEETLQGRHSAKDRPIPSPMASLSRRHSLSWHGDEFQHSAEPG
SKCFAVRSLGWVEIPEEDLAPGKSSIAVNNCIQQLSNSKGQGSAENQGEGQDLVMILKKD
TMSLVDPLDRSLIHHQPILNIRVWGVGCNNGRDRDFAFVASDKDTCVLKCHVFHCNVPAK
GIAKALHEMCSKIVAERAVASSRLPRAATLEPISAEDLPLQVDILEAVRQSMQTYEALYI
GSLPVPRAMGMDVLNEAIEKLTRRPGREIWTPSLIHVSDTAMRVHPAQPEEAAHIWECQV
RYVTFLGVGRDAHTFALIVDTGRRFQCAAFWCEPDAGTISEAVQAACMV
Download sequence
Identical sequences H0YTX1
59729.ENSTGUP00000001737 ENSTGUP00000001737 ENSTGUP00000001737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]