SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001751 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001751
Domain Number 1 Region: 23-109
Classification Level Classification E-value
Superfamily UBA-like 6.68e-32
Family UBA domain 0.0000734
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001751   Gene: ENSTGUG00000001689   Transcript: ENSTGUT00000001767
Sequence length 1136
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:38033040:38105344:-1 gene:ENSTGUG00000001689 transcript:ENSTGUT00000001767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTSVGSEHTRGTRDKMQISATQPIQPQKQVVQATAEQIRLAQMIYDKNDADFEDKVKQL
MEVTGKNQDECIVALHDCNGDVNRAINILLEGSSDTTSWETVGGKKKTLGKEGSENKENR
EKRGDREVSRGRGSSNRRGRGGSRGREFRAEENGVDNSQGDRPSDRGKRGRGRGFGRGRG
RGAGRFSAQGMGTFNPADYMESSATDGFGTKSEIWETGQNDADDGTGKMLQEVEGLESVF
FLSPIVIGAWKNSIEEWTAEDWNEDLSETKVFTASSVPAENHVTPGQSIDLVTLLQKPVT
STQETEGNSFESPQQQTFGQALVFTNSQHSTQMASGTGSSSAVNSYSPQSLSAVLCSGFG
ELRSSKLANSTGSQILDQLKSPGLGQFTSQQTNSSSASTSTVAASSWDLKPPSTQSSVLS
QFDFKSQPEPSPVLSQLTQQQQQMQVVPVPPPGLESSSSQVKLQQPSSVDTSTAVSKILQ
LPTISMDNQAVTVHQTHQKQIKPPKRRITPASKIPSSAVEMPGSADITGLNVQFGALEFG
SEPTLPEFGSTSSSENTNQATNNSLYSKSVNDPLNTSLPISNTAQDSTYTTSAISSSSLT
CSSQNTSPVTASSYDQTSVHSRIAYQSSMAPSEPTPVAVTNGHSGVRTQATLDTISSVAA
PKTESSPSLPSAGSLPSVVSTTASLLPSASQHMAALPTLPQSSDLASSSLSQLSSSLPNH
QTSLSPASVLSSGTSHVHTSIENTTSLQPSTTFSTASTSATSTTSSVVSMTSSMNTTNSL
GLSVTSVSIPAATTRAAPLMSSGKAPPNLPQGVPPLLHNQYIVGPGGLLPAYPIYGYDDL
QMLQSRLPMDYYGITFPAPATLTGRDGSLANNPYSGDVTKYGRGDTASPAPATTLAQPQQ
NHTQTHHTTQQPFLNPTLPPGYSYTGLPYYAGMPGVPSAFQYGPTMFVPPASAKQHGVNL
NTASTPFQQTSGYSQHGYGAAGYDDLSQGTAPGDYSKGGYSGSSQAQNKSAGTGPGKGVS
VTSSNTGVPDISGSVYNKTQQTFDKQGFHAGTPPPFSLPSALGSTGPLNPGAAPGYAPAP
FLHILPAHQQPHSQMLHHHLQQDGQGGSGQRNQPSTMQQKSQATKTTYGTSPYWTN
Download sequence
Identical sequences H0YTY4
ENSTGUP00000001751 ENSTGUP00000001751 59729.ENSTGUP00000001751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]