SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001761 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001761
Domain Number 1 Region: 391-437
Classification Level Classification E-value
Superfamily UBA-like 0.00000000397
Family UBA domain 0.0007
Further Details:      
 
Domain Number 2 Region: 453-503
Classification Level Classification E-value
Superfamily UBA-like 0.0000168
Family UBA domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001761   Gene: ENSTGUG00000001708   Transcript: ENSTGUT00000001777
Sequence length 507
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:38189273:38204076:1 gene:ENSTGUG00000001708 transcript:ENSTGUT00000001777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKKLGSDSHGPFSYLDDVPFKIGDKFKTPAKVGLPIGFCLSDSSQLVREAQYDFSLEK
KTIEWAEDIKKIQAAQRQAEHKAEEALANSKAAPEDNTKMGFSEGPCPEAMPPPINPILA
SLQHNNILTPTPANTSSVKQKVLSPPHPKADFNPADFECEEDPFDKLELKTIDDKEELKN
ILEIHVGTTGPIVAQLLDNTLPKGGSESVLQDEEVLASIEKATLDFKPLHKPNGFITLPQ
LGNCEKMSLSSKVSLSPITSVSNIKSLSFPKLDSDEGDQKSSKFTSTFHSTTCLRNGTLL
GSLQTCAQSKASELNGHHMLGLSALNEDSGRETVSSSSRLSSLAVSTVCTEEESSQSTST
TVTHQNFAVSKVSNSSSCTKWPGGLAAELQQGLSPSERHCVETVVNMGYSPENVLKAMRK
KGQNIDQVLDYLFAHGQLCEKGFDPLLVEAALEMHQCSEEKITELLQLMSQFKEMGFELK
DIKEVLLLHNNDQHSALEDLMARAGAS
Download sequence
Identical sequences H0YTZ4
ENSTGUP00000001761 ENSTGUP00000001761 59729.ENSTGUP00000001761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]