SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001799 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001799
Domain Number 1 Region: 233-342
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-32
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 2 Region: 56-175
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-32
Family Spermadhesin, CUB domain 0.00062
Further Details:      
 
Domain Number 3 Region: 405-513
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-31
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 4 Region: 574-693
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-24
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 5 Region: 940-1008
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.42e-19
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 6 Region: 1180-1247
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.78e-19
Family Complement control module/SCR domain 0.00067
Further Details:      
 
Domain Number 7 Region: 1296-1367
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.17e-18
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 8 Region: 997-1065
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.7e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 9 Region: 1356-1425
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.35e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 10 Region: 1237-1307
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.2e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 11 Region: 1056-1123
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000132
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 12 Region: 882-944
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 13 Region: 347-415
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000764
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 14 Region: 1112-1173
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000124
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 15 Region: 174-236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000131
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 16 Region: 755-822
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000347
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 17 Region: 692-759
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000111
Family Complement control module/SCR domain 0.00099
Further Details:      
 
Domain Number 18 Region: 1476-1546
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000025
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 19 Region: 1408-1470
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000005
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 20 Region: 1537-1595
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000264
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 21 Region: 826-888
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000834
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 22 Region: 517-584
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000256
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 23 Region: 1-67
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000278
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001799   Gene: ENSTGUG00000001744   Transcript: ENSTGUT00000001816
Sequence length 1836
Comment pep:known_by_projection chromosome:taeGut3.2.4:23:5965486:6187105:1 gene:ENSTGUG00000001744 transcript:ENSTGUT00000001816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSSVPECLFLRYLFISLRLGSSIQFSCNEGYDLQGSKSITCKRVSDIIVAWSDHRPVCRV
SCFFNFTSPSGIVLSPNYPEEYGSSLHCVWLIIANPESRIHLAFNDFDVEPQFDFLAVKD
GGTAESPVLGTFSGSHIPSSLTSSGHVARLEFQTDHSMEKRGFNITFTISTATSCNDPGI
PQNGSRSGDSKEAGDSITFQCNPGYALQGHSHISCMPGTVRRWNYPPPLCIAQCGGTAEE
MEGVLLSPGFPGNYPSNLDCTWRILLPVGFGAHIQFLNFSTEPNHDFVEIRNGPYDTSSV
IGRFSGAELPGSLLSTSHETTVYFHSDHSQNKPGFKLEYQAYELQECPDPEPFANGVVRG
AGYNVGQSISFECLPGYQLIGHPVLTCQHGTNRNWDHPLPRCEVPCGGNVTAQNGTIYSP
GFPNQYPNSQDCTWLLTVPVGYGIHLNFTLLQTEPYNDFITVWDGPQQTSPQLGVFTGNS
AKKSAQSSSNQVLLRFHSDAANGGIFAIYFYAFQLFRCQPPTVVPNAEIITENEEFNIAG
DIVRYRCLPGFTLIGNEILTCKLGTHLQFEGPPPTCEVHCPMNQLMTDSTGVILSQSFLG
SYPHFQTCSWVVKVEPGYNISLTIEYFLSEKQFDEFEIFDGPSGQSPLLLSLSGNYSAPL
TVTSSGSSVFLRWSSDHAYNRKGFKIRYSAPYCSLPQPPAHGMILSHSGLRPGSSVRFGC
DAGYRLVGHSTTTCSQHPQGHFHWREATPLCQALSCGVPRAPRNGVVFGKEYTVGTKAVY
QCNQGFQLQPGAQPSAECLQEGVWSNGNQPPLCLAVTCPDVSSIAVEHGRWRLTYEVQYH
YNAQLMLICDPGYYYTGQRVISCQANGTWSIGQPVPTCKIISCGDLPTPPNGNKIGTLTS
YGATAIFSCNTGYTLVGSRVRECMANGLWSGAEVRCLAGHCGVPSPIVNGQINGENYNYR
GSVVYQCQPGFRLIGMSVRICQQDHRWSGKTPVCVPITCGHPGNPPNGLTQGSQFNLNDV
AKFQCNPGFRLEGASQSQCLANGQWSSTLPACRVVNCSDPGHLENSVRQVQPSGPHRFSF
GTTVSYQCIHGFYLLGSHVLTCQGDGTWDRALPQCLLVSCGHPGSPPHAQISGDKHTVGS
VVRYSCLGRRTLVGNATRMCQLDGRWSGSLPHCSGGSQGVCGDPGIPSHGIGLGDAFDVG
SVVRFSCEPGYTLRGSSERTCHPNGSWSGTQPECEVISCGNPGTPSNARVIFNDGLVFSS
SIIYQCREGFYSTGVLSRHCTVNGTWTGTSPECTVINCGDPGVPANGLRLGSDFTYNKSV
VFQCTPGFMMESDRAAALTCTKDRTWNGTKPVCKAITCRAPQAIPNGKVVGSDFSWGSSI
SYACLEGYQLSLPAVLTCEGNGSWSGEIPQCFPVFCGDPGTPAQGRREDRGFTYRSSVSF
SCLAPLVLVGSARRFCQSDGTWSGTQPSCIDPSLTTCADPGVPLFGMQNNSQGYQGQVGS
ILFFRCQKGYLLQGSTTRTCLPNLTWSGVQPDCVPHHCKQPETPSHANVGALDLPSLGYT
LIYSCQSGFYLTGGSEHRTCKADGSWTGKPPICMADIRPSGRPVGTAREPPLAKVSVPAD
VFARNSLWKGSYEYMGKKQPAMLSVTSFDPATSKVNATLIDHSGVELQVSGIYKKEDVHL
LLQVYQIMGPLEIFANKFRNDKWALDGHVSSESSSGTFVYQGFVRGKGFGQFGLQRLDIS
MMENDPESIGHHFASNSSSVAAAILVPFIALIIAGFVLYLYKHRRRPKVPFNGYAGHENT
NVRGTFENPMYDRNLQPSDIMAGEAEFTVSTVCTAV
Download sequence
Identical sequences H0YU31
ENSTGUP00000001799 ENSTGUP00000001799 59729.ENSTGUP00000001799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]