SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001809 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001809
Domain Number 1 Region: 772-880
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-23
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 2 Region: 250-374
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-18
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 3-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.52e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 212-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 588-700
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000406
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 6 Region: 132-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000402
Family EGF-type module 0.018
Further Details:      
 
Domain Number 7 Region: 173-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000229
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001809   Gene: ENSTGUG00000001750   Transcript: ENSTGUT00000001826
Sequence length 955
Comment pep:known_by_projection chromosome:taeGut3.2.4:26:4204157:4224023:-1 gene:ENSTGUG00000001750 transcript:ENSTGUT00000001826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDECVEGTDNCHIDAICQNTPKSYKCICKSGYTGDGKHCKDVDECEREDNAGCVHECVN
IPGNYRCTCYDGFRLAHDGHNCLDLDECSEGNGGCQQTCVNMMGSYECFCREGFFLSDNQ
HTCIQRPEEGMNCMNKNHGCAHICRETPKGGIACECRPGFELTKNQRDCKLTCNYGNGGC
QHTCDDTDQGPKCGCHVKFLLHSDGVTCIETCAVNNGGCDSKCHDAATGVHCSCPMGFML
QPDRKTCKDIDECRLNNGGCDHICRNTVGSFECSCKKGYKLLINERNCQDIDECSFDRTC
DHLCINTPGSFQCLCHKGYTLYGLTHCGDIDECSINRGGCKFGCINTPGSYQCTCPAGCK
LHWNKKDCVALVKCLPGSVPPRATLTCNKMGKKDSCALSCTSKARFLPESDSSYTVSCGT
PVLRQGGQHRATNSSQQCLETVAAPVKQKASFKIKDAKCHLHPRTRGKQEDAGKAGAQGG
SAPCSDCQVTFVNLKCDSSKKGKGRRARNSPSKEVTRITLEFEAEIKPEEITASCNLHCL
RQRVEKKLKSAIKALKKSINQERFLLRFSGMEYEVARKLSVAPERQESCGPGQQRLASKC
VSCSQGTYYHGQTEQCVPCPPGTYQEKEGQLSCDLCPRGDTFGPIGATNITGCTGQCPPG
QHSADGFKPCQPCPRGSYQPEVGRALCFPCGGGLTTRHEGALSFQDCDTKVQCSPGHYYN
TSVHRCIRCAVGTYQPDFRQNYCISCPGNTTTDFDGSTSVSQCKNRQCGGELGEYTGYIE
SPNYPGNYPANIECTWNINPPPKRKILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYE
TCQTYERPIAFTARSRKLWINFKTSEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYAS
ENHQEILKDKKLIKAFFDVLAHPQNYFKYTEKHKEMLPSFIKLLRSKVSSFRPYK
Download sequence
Identical sequences H0YU41
ENSTGUP00000001809 ENSTGUP00000001809 59729.ENSTGUP00000001809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]