SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001816 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001816
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000202
Family Link domain 0.02
Further Details:      
 
Domain Number 2 Region: 104-164
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000417
Family Complement control module/SCR domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001816   Gene: ENSTGUG00000001761   Transcript: ENSTGUT00000001833
Sequence length 590
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:29894266:29925416:1 gene:ENSTGUG00000001761 transcript:ENSTGUT00000001833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAGKVFALESKNNSQGLDLAKAEKACVDLSARLATAEELKRAVLDCSFAGCTTGWLASGS
AGTIICRKTGSKQQSVKAIDVKIETDPFVNDQYDAFCVKDEDKPCGDPPSFPHTILHGHT
GFEMGDELLYVCAQGYVMGNKETAFTLLCDSCGEWYGQVQACVKDETEAHIDYEDNFPDD
RSIPVAEKDHGNDKKEIEEEQIQLSFSKTSEEGRTGSTKGVTQHTDISEKGSRAPTESPV
SLLSQKNLFWFPSETFSEPEPEKETDDSTKAQFSEGDNHIGVKTVYDEPGAKMFYDSEDF
PIGPILTTSNSKTGMDAVAITDESWLDGYPVTQEVVEDDEEGDKVDGSMGTEDDIILTTD
QPNHVEVRKSGNGSPAPEEGLTQIVAATTAVDDEGAEDTAVPLTSVSGLENFNVSKGYDD
AMWEHLATSLESVTQEPTTTMLFDISSLKPSMSETSVTVSPSDHAPYTEPRDTTTYPEEV
ATTAPAPDVITDTASQELAEQENLTQGLGEKPIPTSEPCEGEDCPKSSKGAIIAVIVILL
CLLLVAAVLAVWFFKKRQQKNSVYKLNGRCQPKHHCYHHYHHQHIEMQKV
Download sequence
Identical sequences H0YU48
ENSTGUP00000001816 59729.ENSTGUP00000001816 ENSTGUP00000001816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]