SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001838 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001838
Domain Number 1 Region: 58-104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000649
Family EGF-type module 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001838   Gene: ENSTGUG00000001783   Transcript: ENSTGUT00000001856
Sequence length 171
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:2536802:2538702:-1 gene:ENSTGUG00000001783 transcript:ENSTGUT00000001856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAAAPVPGGGPGTLLLCLALASGKHGSPPAPPPARPVPGLPPQVSAGNGTQLRRHSHF
SRCPEEYQHYCVKGRCRFLVAEEAPACVCERGYTGARCERVDLFYLRGDQGQIVIISLIV
GIVALIILVVGICLCSHHCRRQRRKRKAEEMETLNKDGPSRSEDVRETGIA
Download sequence
Identical sequences H0YU70
ENSTGUP00000001838 ENSTGUP00000001838 59729.ENSTGUP00000001838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]