SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001856 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001856
Domain Number 1 Region: 342-517
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-35
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 524-739
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.88e-35
Family Laminin G-like module 0.0049
Further Details:      
 
Domain Number 3 Region: 3-109
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.85e-16
Family Laminin G-like module 0.0054
Further Details:      
 
Domain Number 4 Region: 136-193
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000044
Family Fibrinogen C-terminal domain-like 0.0034
Further Details:      
 
Domain Number 5 Region: 106-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000347
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001856   Gene: ENSTGUG00000001794   Transcript: ENSTGUT00000001874
Sequence length 882
Comment pep:known chromosome:taeGut3.2.4:2:30184705:30635452:-1 gene:ENSTGUG00000001794 transcript:ENSTGUT00000001874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSGLNDGQWHEVRFLAKENFAVLTIDGDEASAVRTNSPLQVKTGEKYFFGGFPVQMNDSD
HSLFEHSFQGCMQSIHVDDQLVDLHAVEQGELGSFANVTIDMCAIIDRCVPNHCEHDGKC
TQTWDSFKCTCDGTNYSGATCHNSIYELSCEAYKHLGKTSNYYWIDPDGSGTLGPLKVYC
NMTEDKVWTTVYHDLQMQTSVGGNSPEKLSVLQLNYSATMDQISAITGSAEYCEQFISYS
CKMSRLLNTPEGNPYTWWVGKANEKHYYWGGSGPGIQKCACGIERNCTDPKYYCNCDADY
KQWRKDSGMLSYKEHLPVSQVVVGDLDRPGSEAKVSVGPVRCQGDRNYWNAASFVTSSSY
LHFSTFQGETSADISFYFKTSASDGVFLENLGNTDFIKLELKSATEVSFSFDVGNGPVEI
VVRSPNPLNDDQWHRVNAERNVKQASLQVDQLPLEVRKAPTEGHTRLELYSQLYVGAAGG
QRGFLGCIRSLRMNGVTLDLEERAKVTPGVKPGCSGHCTSYGMYCANGGKCVEKYNGYSC
DCSKTAYDGPFCIKDVGAFFEEGMWLRYNFHSPGTSMKDLVSRTLLSSADPEITAPDLSL
NKEELSFSFSTTKSPCVLFYVSSYTPDFMAVLVNPTGNLQIRYNLGGTKEPYNIDIDHRN
MANGQPHTVNVTRNGRDIVLQLDHYPPTSYSLPATSDIQFNSPKALFLGKVIEIGKIDQD
IYKYNTPGFTGCLSRVQFNQIAPLKAALRPTNASSHVHIQGELVESNCGASPLTIPPMSA
ATDPWHLDSVFTASADFPYNGQAIGDGVNRNSAIIGGVIAVVIFTILCTLVFLIRYMFRH
KGTYHTNEAKGAESAESADAAIMNNDPNFTETIDESKKEWLI
Download sequence
Identical sequences H0YU88
ENSTGUP00000001856 59729.ENSTGUP00000001856 ENSTGUP00000001856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]