SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001863 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001863
Domain Number 1 Region: 681-980
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-79
Family Protein kinases, catalytic subunit 0.0000000000431
Further Details:      
 
Domain Number 2 Region: 300-492
Classification Level Classification E-value
Superfamily L domain-like 4.82e-46
Family L domain 0.0000014
Further Details:      
 
Domain Number 3 Region: 20-181
Classification Level Classification E-value
Superfamily L domain-like 3.97e-41
Family L domain 0.00000609
Further Details:      
 
Domain Number 4 Region: 477-611
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.11e-22
Family Growth factor receptor domain 0.000000952
Further Details:      
 
Domain Number 5 Region: 158-311
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.36e-19
Family Growth factor receptor domain 0.0000000719
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001863   Gene: ENSTGUG00000001806   Transcript: ENSTGUT00000001881
Sequence length 1185
Comment pep:novel chromosome:taeGut3.2.4:2:32242358:32284289:1 gene:ENSTGUG00000001806 transcript:ENSTGUT00000001881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCQGTNNKLTQLGHVEDHFTSLQRMYNNCEVVLSNLEITYVEHNRDLSFLKTIQEVAGYV
LIALNMVDVIPLENLQIIRGNVLYDNSYALAVLSNYHMNKTQGLRQLPMKRLSEILNGGV
KISNNPKLCNMDTVLWNDIIDTSKKPPTVLEFASNLSSCPKCHQNCTEDHCWGPGEKNCQ
TLTKVICAQQCSGRCRGKVPSDCCHNQCAAGCTGPRESDCLACRKFRDDATCKDTCPPLV
LYNPTTYQMDVNPEGKYSFGATCVKECPHNYVVTDHGSCVRSCNADTYEVEENGVRKCKK
CDGLCSKVCNGIGIGELKGILSINATNIDSFKNCTKINGDVSILPVAFLGDAFTKTLPLD
PKKLDVFKTVKEISGFLLIQAWPENATDLYAFENLEIIRGRTKQHGQYSLAVVNLKIQSL
GLRSLKEISDGDVAIMRNKNLCYADTMDWHSLFATESQKTKILQNRDKNECAAAKHVCDP
LCSDVGCWGPGPFHCFSCRFFDRQKECVKQCNILQGEPREFEKDSKCLPCHPECLVQNST
MYNATCTGPGPDNCMKCAHFIDGPHCVKSCPAGVLGENDTLVWKYADGNNVCQLCHPNCT
RGCKGPGLEGCPNGSKIPSIAAGVVGGLLCLVVVGLGIGLYLRRRHIVRKRTLRRLLQER
ELVEPLTPSGEAPNQAHLRILKETEFKKVKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKE
LREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYIREHK
DNIGSQYLLNWCVQIAKGMNYLEERRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGADE
KEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYEGIPASEISSV
LEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIAEFSKMARDPPRYLVIQGDDR
MHLPSPTDSKFYRTLMEEEDMEDIVDADEYLVPHQGFFNSPSTSRTPLLSSLSATSNNSA
TTCIDRNGQGHPVREDSFVQRYSSDPTGAFLEDSLDDSFLPAPEYVNQLVPNKTSASAVQ
NPIYNFSHTANSKASTDSSYQNSHSTAVDNPEYLNTNQSPLAKTVFESSPYWIQAGNHQI
NLDNPDYQQDFLPKETKSNGLLKVPAAENPEYLRVAAPKSEYIEA
Download sequence
Identical sequences H0YU95
ENSTGUP00000001863 ENSTGUP00000001863 59729.ENSTGUP00000001863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]