SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001875 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000001875
Domain Number - Region: 467-506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0695
Family EGF-type module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001875   Gene: ENSTGUG00000001820   Transcript: ENSTGUT00000001893
Sequence length 556
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:39746188:39751657:-1 gene:ENSTGUG00000001820 transcript:ENSTGUT00000001893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADGLFVTDYFTRTPRKLSPFRSFASIELFHFHIPEDTVIAVWNLITFKEQGGTFGDQCPD
RSITVYFRSGAPSVINPLHTHFPRDTAVPGSFALTLTWTLPNRTTGVFNVTSPLPGDWFL
AAHLPKDEGKISVKGLYEECQYLFQPQLIVQRLVNIAVLYPGHVTEQSMAPHNRSCLYKV
FVPSYTSQVLVEVLRCRGAEGCPLWLRVRAKAPPLHNSTTLDCQEHTPCQLAQDLPFWQH
WYYVLVEKHPGVPGTVSFQVTVQLTDCSRPSLARPPFLPSSASMNMPHSFGSAALHPPAP
TTHPVPIPVTLHTGEQCWPVRPTLRNELDTFSVHFYIFFGPNVSVPPDRPAVFVINLLPV
LDSGGVLNLELRLNVSSLCGENVTVFGCLNHGVPLTSSDNTSVICETESLAGFLLSVNAT
ASLSRLRIPYPQTGSWYLSLRSLCATEHGFEPCTNVTAEVYLRAYLSPCINDCGIYGQCK
LLRTNNYLYAACECKAGWNGWGCTDNAEAFSYGFQLLSTLLLCLSNVMFVPPVAIAVRSH
YLLEAAVYIFTMFFST
Download sequence
Identical sequences H0YUA7
ENSTGUP00000001875 ENSTGUP00000001875 59729.ENSTGUP00000001875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]