SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001876 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001876
Domain Number 1 Region: 408-574
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.48e-54
Family IP3 receptor type 1 binding core, domain 2 0.000000341
Further Details:      
 
Domain Number 2 Region: 213-406
Classification Level Classification E-value
Superfamily MIR domain 1.57e-47
Family MIR domain 0.0000007
Further Details:      
 
Domain Number 3 Region: 1091-1241
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.1e-34
Family IP3 receptor type 1 binding core, domain 2 0.0083
Further Details:      
 
Domain Number 4 Region: 85-195
Classification Level Classification E-value
Superfamily MIR domain 2.62e-19
Family MIR domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000001876
Domain Number - Region: 2578-2628
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0023
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001876   Gene: ENSTGUG00000001798   Transcript: ENSTGUT00000001894
Sequence length 2640
Comment pep:known_by_projection chromosome:taeGut3.2.4:26:4631485:4664847:-1 gene:ENSTGUG00000001798 transcript:ENSTGUT00000001894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLVPLRLVDDRCVVEPAAGDLDNPPKKFRDCLFKVCPMNRYSAQKQYWKAKQTKQDKDKI
ADVVLLQKLQHAAQMEQKQNETENKKVHGDVVKYGSVIQLLHMKSNKYLTVNKRLPALLE
KNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVGDKVILNPVNAGQPLHASNYELADN
AGCKEVNSVNCNTSWKINLFMQFCDHMEEVLKGGDVVRLFHAEQEKFLTCDEYKGKLHVF
LRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHWNGLYRFKHLATGNYLAAEENPSYK
GDVAEPKAAPTGGSSRASRRNTGEKIKYRLVAVPHGNDIASLFELDPTTLQKKDSFVPRG
QRGRDEEECWRKGQCWRVPVGERPIRLMLGTCPTKEDKEAFAIVSVPVSEIRDLDFANDA
SSMLASVVEKMNEGFLSQNDRRFVIQLLEDLVFFVSDVPNNGQNVLDIVVTKPNRERQKL
MREQNILKQIFGILKAPFKDKGGEGPLVRLEELSDQKNAPYQYMFRLCYRVLRHSQEDYR
KNQEHIAKQFGMMQSQIGYDILAEDTITALLHNNRKLLEKHITKTEVETFVSLVRKNREP
RFLDYLSDLCVSNHIAIPVTQELICKCVLDSKNSDILIKTELRPVKEMSQTHEYLSIEYL
EEEVWLTWTDKNNDHHEKSIRQLAQEARAGNAHDENVLSYYRYQLKLFARMCLDRQYLAI
KEISQQLGVDLIFLCMADEMLPFDLRASFCHLMLHVHVDRDPQELVMPVKFARLWTEIPT
AITIKDYDSNLNVSRDDKKNKFASTMEFVEDYLNNVVSEAVPFANEEKNKLTFEVVSLAH
NLIYFGFYSFSELLRLTRTLLGIIDCVQNPQLMMQAVYNDEGGKNVRRSIQGVGQMMSTM
VLSRKQSIFSPPSLSTGSAPEQVDRGRSIESENIVVMETKLKILEILQFILNVRLDYRIS
YLLSVFKKEFVEVYPMQDSAADGTAPAFDSTTAAMNLDRIGEHAEAMFGVGKSSSMLEVD
DEGGRMFLRVLIHLTMHDYPPLISGSLQLLFKHFSQRQEVLHTFKQVQLLISAQDVENYK
VIKSELDKLRTMVEKSELWVDKKGSTKGDSTGEGNKKEKKEHGADEEVIAPGEKSSENYQ
IVKGILERLNKMCGVGEQVRKKQQRLLKNMDAHKVMLDLLQIPYEKGDAKMMEILKFTHQ
FLQKFCAGNQENQALLHKHLNLFLTPGLLEAETMQHIFLNNYQLCSEINETVPQHFIHCV
ATHGRHVQYLDFLHTIIKAEGKYVKKCQDMIMTELTNAGDDVVVFYNDKASLATLLEMMT
AARDGVEENSPLMYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVRVVTHEDCITEVK
MAYVNFVNHCYVDTEVEMKEIYTSNHIWTLFENFTLDMAQMCKKREKRLPDATLEKYVLT
VVLDTINAFFSSPFSENSTSLQTHQTIVVQLLQSTMRLLECPWLQQQHKSSVESCIRTLA
MVAKSRSIALPMDLDAHVSSLLNSSSTSTVQRNTSSYKAATRSFPRVSTTPNQWDYKNII
EKLQDIISALEDRLKPLVEAELSVLVDVLHRPELLFMEGTEAFQRCESGGFLSKLVQHTK
DLMETEEKLCIKVLRTLQQMLVKRNKYGERGNLLRKMLMNNYLQNKRSSSKGEMGDAAGG
GQDQDWSAIAAVQCRLDREGATKLVADLIMNTKNEKIFQESILLAIRLLDGGNTEIQKSF
YNLMTSDKKSEKFFKVLHDRMKKAQQETKSTVSVNMSDIGNKPREDKDEPEPGTKGRGDT
FLMPGTPTRYPMAVGFRKGHDPGEQGQNNEMGVTVLIMEPILRFLQLLCENHNRDLQVAA
GALGLGWGKVGICPSFWLPKCCGTQQLCASLGVVGGVCGRTGCGTEVCRLQGRSQPKCPS
NCGWRGSCIVTHESNGIDIITALILNDISPLCKYRMDLVLQLKDNASKLLLALMESRHDS
ENAERILISLRPQELVDVIKKAYLQEEECENAEVSPREVGHNIYILALQLSRHNKSLQQL
LKPVKRIQEEEEEGISSMLSLNNKQLSQMLKSTAPVQEEEEDPLAYYEKHTSQIEAIVRL
DRSMEQIIFPVPGICEFLTKETKYRLFTTTEQDEQGSKVSDFFDQSSFLHNEMEWQKKLR
SMPLMYWFSRRMTLWGSISFNLAVFINIIIAFFYPYVEATSMGVLDSPLISLLFWILICF
SIMALFTKRYGVRPLLVALILRSIYYLGIGLTLNILGALNLTNKIVFVVSFVGNRGTFIR
GYKAMIMDVEFLYHVGYIVTSVLGLFVHELFYSILLFDLIYREETLFNVIKSVTRNGRSI
LLTALLALILVYLFSIVGFLFLKDDFILEVDRLPDSKAKDDPLGMQKNLETFMESCSSDK
ISCSAAPVETPAVSAEPEQWERACDTLLMCIVTVLNHGLRNGGGVGDILRKPSKDESLFP
ARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNK
TVSFEEHIKYEHNMWNYLYFIVLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLV
SNEGEGEQNEIRNLQDKLNTTMKLVSHLTSQLNELKEQMTEQRKRRQRMGFVDVQNTMNH
Download sequence
Identical sequences H0YUA8
59729.ENSTGUP00000001876 ENSTGUP00000001876 ENSTGUP00000001876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]