SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001878 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001878
Domain Number 1 Region: 1238-1598
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.54e-123
Family Hect, E3 ligase catalytic domain 0.00000000972
Further Details:      
 
Domain Number 2 Region: 827-863
Classification Level Classification E-value
Superfamily WW domain 0.00000000000415
Family WW domain 0.0014
Further Details:      
 
Domain Number 3 Region: 220-361
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000792
Family Synaptotagmin-like (S variant) 0.066
Further Details:      
 
Domain Number 4 Region: 1008-1050
Classification Level Classification E-value
Superfamily WW domain 0.000000000145
Family WW domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000001878
Domain Number - Region: 666-709
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00895
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001878   Gene: ENSTGUG00000001817   Transcript: ENSTGUT00000001896
Sequence length 1604
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:32646969:32818185:-1 gene:ENSTGUG00000001817 transcript:ENSTGUT00000001896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CKYYPFFFSSQNLYQNRFLGLAAMASPSRNSQNRRRCKEPLRYSYNPDQFHNMDIRNNSH
ETVTIPRSTSDTDLVTSDSRSTLMVSSSYYSIGHSQDLVIYWDIKEEVDAGDWIGMYLID
EVLSENFLDYKNRGVNGSHRGQIIWKIDASSYFVEPETKICFKYYHGVSGALRATTPSVT
VKNNAAPIFKSITNEDSVQGQGSRRLISFSLSDFQAFGLKKGMFFNPDPYLKISIQPGKH
SIFPALPHHGQEKRSKIICNTVNPVWQGEQFSFVSLPTDVLEIEVKDKFAKSRPIIKRFL
GKLSMPVQRLLERHAIGDRVVSYTLGRRLPTDHVSGQLQFRFEITSSIHPDDEEVSISAD
PEPADLPESPVNNPTEESLGEPPCINTVTSESAAPEQLNGYSVNSVDSPGAVKPPGEVNQ
NSLNEELAGDGEVDAVPVPEPLESIPGEVLLLSATDLMEQSVRENDKVNSGMQGDGGVLT
SVETVDIDEVSADVHAGKDLEKSQEEEEEGASAQEEEDSKLQLRTTAKRKNRPCSLPVSE
LETVIASACGEPETPRTHYIRIHNLLHSLPSAQMSSDGEEEQDGGNGRENDEESTVKEVM
DKEVVSESETMAAEPPLENEAEENFSQNTVPPGTLDEQLSDLNDGLLDGEPPRTGSESES
SSRPNGDNECEACDTSCYSPSCYSPSCYSTSCYSTSCYSTSCYSTSCYDSNNRFSSHTRF
SSVDSAKISESTVFSSQDDDEEENSAFESVPDSVQSPELDREQVDGSSQWPDELVAHGGN
PQRATEGLDTPVAGPSSRREGDCPLLHNSQPVSQLPSLRPDHHHYPTIDEPLPPNWEARI
DSHGRVFYVDHVNRTTTWQRPTAAATPDGIHRSGSIQQMEQLNRRYQNIQRTIATERTED
DAVVNNRVERVPTGGGSDSEAEPSQPSPEIRREGSLSPVNSQKITLLLQSPAVKFITNPE
FFTVLHANYSAYRVFTNSTCLKHMILKIRRDARNFERYQHNRDLVNFINMFADTRLELPR
GWEIKTDQQGKSFFVDHNSRATTFIDPRIPLQNGRLPNHLTHRQHLQRLRSYSAGEASEV
SRNRGVTLLARPGNSLVTAIRNQHHHEALPLAYNDKIVAFLRQPNIFEMLQERQPSLARN
HALREKIHYIRTEGTHGLEKLSCDADLVILLSLFEEDIMSYIPLQAAFHPGYSFSPRCSP
CSSPQNSPGLQRASARAPSPYRRDFEAKLRNFYRKLEAKGYGQGPGKIKLIIRRDHLLEG
TFNQVMAYSRKELQRNKLYVTFVGEEGLDYSGPSREFFFLLSQELFNPYYGLFEYSANDT
YTVQISPMSAFVENHLEWFRFSGRILGLALIHQYLLDAFFTRPFYKALLRLPCDLSDLEY
LDEEFHQSLQWMKDNNITDILDLTFTVNEEVFGQVTERELKSGGANTAVTEKNKKEYIER
MVKWRVERGVVQQTEALVRGFYEVVDSRLVSVFDARELELVIAGTAEIDLNDWRNNTEYR
GGYHDGHIVIRWFWAAVERFNNEQRLRLLQFVTGTSSVPYEGFAALRGSNGLRRFCIEKW
GKITSLPRAHTCFNRLDLPPYPSYSMLYEKLLTAVEETSTFGLE
Download sequence
Identical sequences H0YUB0
ENSTGUP00000001878 ENSTGUP00000001878 59729.ENSTGUP00000001878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]