SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001898 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001898
Domain Number 1 Region: 312-423
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.72e-38
Family Transforming growth factor (TGF)-beta 0.000000453
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001898   Gene: ENSTGUG00000001843   Transcript: ENSTGUT00000001916
Sequence length 424
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:33558179:33570469:1 gene:ENSTGUG00000001843 transcript:ENSTGUT00000001916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLWKRGFLLVLCWIIVRSSPTPGSEGHSSVTDCPSCALATLSKDVPSSQPEMVEAVKK
HILNMLHLRDRPNITQPVPKAALLNAIKKLHVGKVGEDGYVEIEDDVGRRAEMNEVVEQT
SEIITFAESGTAKKMLHFEISKEGSELSVVEHAEVWLFLKVSKANRSRTKVTIRLFQQQR
QPRGNSEGAEDTEDGGLKGEKSETLISEKAVDTRKSTWHIFPVSSSVQRLLDQGKSSLDV
RIACDLCQETGANLVLLGKKKKKEDDGEGKEKEAGEITGEEEKEQSHRPFLMMLARHSED
RQHRRRRRGLECDGKVNICCKKQFFVSFKDIGWSDWIIAPTGYHANYCEGECPSHIAGTS
GSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEE
CGCS
Download sequence
Identical sequences H0YUD0
XP_002198753.1.42559 XP_012426950.1.42559 59729.ENSTGUP00000001898 ENSTGUP00000001898 ENSTGUP00000001898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]