SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001921 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001921
Domain Number 1 Region: 450-705
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.95e-82
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 111-215
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000455
Further Details:      
 
Domain Number 3 Region: 331-433
Classification Level Classification E-value
Superfamily SRCR-like 4.58e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000791
Further Details:      
 
Domain Number 4 Region: 218-320
Classification Level Classification E-value
Superfamily SRCR-like 8.63e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00021
Further Details:      
 
Domain Number 5 Region: 2-104
Classification Level Classification E-value
Superfamily SRCR-like 1.14e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001921   Gene: ENSTGUG00000001861   Transcript: ENSTGUT00000001939
Sequence length 707
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:4303091:4327893:-1 gene:ENSTGUG00000001861 transcript:ENSTGUT00000001939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSVRLRGGKNEFEGTVEVYLNGIWGTVCGNHWDNNDATVVCRQLALGEKGTAKHIPFSAL
GLIPVFWSEVRCRGDEENILLCEKDTWQDGTCPQKMAAAVTCSSSLGPVFTPIRLAGGSN
AHEGRVEVYHSGQWGTVCDDQWDDADAEVVCRQLGFGGVARAWSQAYFGEGSGPVLLDEV
QCTGNELSIEQCPKSSWREHNCGHKEDAGVSCTPLTEGALRLTGGKGSHQGRLEVYHAGQ
WGTVCDDGWTELNTQVVCWQLGFKYGKSAESPSEGSSGPIWLDDVICSGKETNLLQCSRR
EWGKHDCNHQEDVRLICHPENDSHKRTLGPPIRLMDGENKKEGRVEIFINGQWGTICDDG
WSDKDAAVVCRQLGYKGPARARTMAYFGEGKGPIHVDNIKCTGNERSLADCIKQDIGMHN
CRHSEDAGVICDHLSKKVPGNSNKDSLASVCGLRLLHRRQKRIIGGKNSLRGGWPWQVAL
RLKSSHGDGRLLCGATLISSCWVLTAAHCFKRYGNNTRNYVVRVGDYHTLVLEEYEEEIG
VQEIVVHKDYRPDSSDYDIALVRLQGPEEQCARFSTHVLPACLPLRRERPQRTAPNCFIT
GWGDTGRSYSRTLQQAAIPLLPKRVCEERYKRRFTGRMLCAGNVQEQKRVDSCQGDSGGP
LMCERPGESWVVYGVTSWGYGCGVKDSPGVYTKVSSFIPWIKSLTKL
Download sequence
Identical sequences H0YUF3
ENSTGUP00000001921 59729.ENSTGUP00000001921 ENSTGUP00000001921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]