SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001925 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001925
Domain Number 1 Region: 488-653
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 2.75e-72
Family A middle domain of Talin 1 0.0000000631
Further Details:      
 
Domain Number 2 Region: 752-888
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.16e-53
Family I/LWEQ domain 0.000000577
Further Details:      
 
Domain Number 3 Region: 2294-2480
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.4e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 4 Region: 658-782
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.62e-51
Family I/LWEQ domain 0.00000137
Further Details:      
 
Domain Number 5 Region: 1840-1972
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.94e-45
Family VBS domain 0.00000125
Further Details:      
 
Domain Number 6 Region: 1223-1360
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.55e-39
Family VBS domain 0.018
Further Details:      
 
Domain Number 7 Region: 195-308
Classification Level Classification E-value
Superfamily Second domain of FERM 7.2e-33
Family Second domain of FERM 0.000000637
Further Details:      
 
Domain Number 8 Region: 309-399
Classification Level Classification E-value
Superfamily PH domain-like 2e-25
Family Third domain of FERM 0.00000822
Further Details:      
 
Domain Number 9 Region: 1074-1206
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 8.47e-24
Family VBS domain 0.044
Further Details:      
 
Domain Number 10 Region: 1466-1554
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000000589
Family I/LWEQ domain 0.0084
Further Details:      
 
Domain Number 11 Region: 1693-1806
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000612
Family VBS domain 0.035
Further Details:      
 
Domain Number 12 Region: 79-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000143
Family First domain of FERM 0.05
Further Details:      
 
Domain Number 13 Region: 2006-2131
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000424
Family VBS domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000001925
Domain Number - Region: 1596-1658
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000879
Family VBS domain 0.072
Further Details:      
 
Domain Number - Region: 920-982
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00155
Family I/LWEQ domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001925   Gene: ENSTGUG00000001853   Transcript: ENSTGUT00000001943
Sequence length 2541
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:39883456:39913057:1 gene:ENSTGUG00000001853 transcript:ENSTGUT00000001943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERVPEAQIGQSNDFGLFLSDEDPKKGI
WLEAGKALDYYMLRNGDTMEYKKKQRPLKIRMLDGTVKTVMVDDSKTVTDMLMTICARIG
ITNYDEYSLVREIMEEKKEEVTGTLKKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGIDDNETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
HQCLIQFGPYNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKGCGDMSEIEAKVCYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDTVSPKKPTVMQQQFNRVGKAELGSVALPAIMRTGAGGPENFQVGTMPQPQLQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVHAAQATLDDFDTLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAVTTISSNLTEMSKGVKLLAALMED
EGGNGRQLLQAAKNLASAVSDLLKTAQPASAEPRQNLLQAAGLVGQTSGELLQQIGESDT
DPRFQDMLMQLAKAVANAAAALVLKAKNVAQKTEDAALQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLIEAGKLVAKSAEGCVEASKAATSDDQLLKQVGVAATAVTQALND
LLQHIKQHALGGQPIGRYDQATDTILNVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGETDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVHKLEHAAKQAAASATQTIAAAQHASSSNKNPAAQQQLVQSCKVVAE
QIPMLVQGVRGSQSQPDSPSSQLALIAASQNFLQPGGKMVAAAKATVPTITDQASAMQLS
QCAKNLAAALAELRTAAQKAQEACGPLEIDSALGLVQSLERDLQEAKAAARDGKLKPLPG
ETMEKCAQDLGNSTKAVSSAIAHLLGEVAQGNENYTGIAAREVAQALRSLSQAARGVAAN
TSDPQAQSAMLECASDVMDKANNLIEEARKAVAKPGDPESQQRLAQVAKAVSQALNRCVN
CLPGQRDVDAAIRMVGEASKRLLSDSFPPSTKSFQEAQSQLNQAAAGLNQSANELVQASR
GTPQDLAKSSGKFGHNFNEFLQAGVEMASQSPNKEDQAQVVSNLKSISMSSSKLLLAAKA
LSADPAAPNLKNQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVKELLENPT
QTVNDMSYFNCLDSVMENSKVLGESMAGISQNAKNSKLPEFGNSISAASKALCGLTEAAA
QAAYLVGVSDPNSQAGQQGLVDPTQFARANQAIQMACQNLVDPACTQSQVLSAATIVAKH
TSALCNTCRLASSRTANPVAKRQFVQSAKEVANSTANLVKTIKALDGEFNEENRERCRAA
TAPLIEAVDNLTAFASNPEFATVPAQISPEGRRAMEPIVISAKTMLESSAGLIQTARSLA
VNPKDPPQWSVLAGHSRTVSDSIKKLITNMRDKAPGQRECDEAIEVLNRCLREVDQASLA
AISQQLAPRQDISQEALHNQMITAVQEISNLIEPVAAAARAEASQLGHKVSQMAQYFEPL
ITAAVGAASKTPNHQQQMNLLDQTKTLAESALQMLYTAKEAGGNPKQAGHTQEALEEAVQ
MMKEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGTFVDYQTTMVKTA
KAIAVTVQEMVTKSTTNPDELGILANQLTHDYGQLAQEAKPAALTAENEEIGSHIKRRVQ
ELGHGCAALVTKAGALQCSPSDAYTKKELIETARKVSEKVSHVLAALQAGNRGTQACITA
ASAVSGIIADLDTTIMFATAGTLNRENSETFADHREGILKTAKALVEDTKVLVQNATASQ
EKLAQAAQSSVSTITRLAEVVKLGAASLGSEDPETQVVLINAVKDVAKALGDLIGATKAA
AGKAGDDPAVYQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATIEHIRQELAVFS
SPVPPAKVSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRSCKE
AAYHPEVSGDVRQRALRFGKECADGYLELLEHVLVILQKPTHELKQQLAGYSKRVASSVT
ELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKQADESLNF
EEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANAVDDGQWSQGLISAARMVA
AATNNLCEAANAAVQGHASEEKLISSAKQVAASTAQLLVACKVKADHDSEAMKRLQAAGN
AVKRASDNLVKAAQKAAAFQDHDETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARKKL
AMIRQQQYKFLPSELRDEEQN
Download sequence
Identical sequences H0YUF7
XP_012433052.1.42559 ENSTGUP00000001925 59729.ENSTGUP00000001925 ENSTGUP00000001925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]