SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001951 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001951
Domain Number 1 Region: 109-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000502
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 2 Region: 67-102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000113
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001951   Gene: ENSTGUG00000001894   Transcript: ENSTGUT00000001969
Sequence length 378
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:40026104:40123355:-1 gene:ENSTGUG00000001894 transcript:ENSTGUT00000001969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLVLLALGHAWTYREEPQDGDREVCSENKIATTRYPCLKSTGELTTCFRKKCCKGYKFVL
GQCIPEDYDVCAEAPCEQQCTDNFGRVLCTCYPGYRYDRERHRNREKPYCLDIDECATSN
GTLCSQICVNTVGSYRCECHEGYVREEDGRTCTKGDKAGNCFLSAGFPEKSENVAKLGTC
CASCKEFHQIKQTVLQLKQKVALLPNNAADLSKQITGEKVLASNAYIPAPPGQPGQPGPP
GAPGPKGSQGAPGLPGPPGQPGPRGSMGPMGPSPDISHIKQGRRGPVGPPGAPGRDGSKG
ERGAPGPKGIPGPPGSFDFLLLMMADIRNDIAELQERVFGHRTHSSTEEFPLPQEFTNYH
DTVDFGSGEDYKPRATSR
Download sequence
Identical sequences H0YUI3
ENSTGUP00000001951 59729.ENSTGUP00000001951 ENSTGUP00000001951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]