SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001981 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001981
Domain Number 1 Region: 77-185
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-26
Family Cadherin 0.00036
Further Details:      
 
Domain Number 2 Region: 303-406
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-25
Family Cadherin 0.0037
Further Details:      
 
Domain Number 3 Region: 186-301
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-23
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 406-514
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000144
Family Cadherin 0.003
Further Details:      
 
Domain Number 5 Region: 4-84
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000343
Family Cadherin 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001981   Gene: ENSTGUG00000001914   Transcript: ENSTGUT00000001999
Sequence length 717
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:35822562:35947657:-1 gene:ENSTGUG00000001914 transcript:ENSTGUT00000001999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLHSDLDKGVGTVKYTLSGDGAGTVFTIDETTGDIHAIRSLDREEKPFYTLRAQAVDVDT
KKPLEPESEFIIKVQDINDNEPKFLDGPYIASVPEMSPVGAYVLQVKATDADDPTYGNSA
RVVYSILQGQPYFSIDPKTGVIRTALPNMDREVKEQYQVLIQAKDMGGQLGGLAGTTTVN
ITLTDVNDNPPRFPKSIFHLKVPETSHVGSAIGRIRAVDPDFGKNAEIEYNIVPGDGGNL
FDITTDEYTQEGVIKLKKPLDFETKKAYTFKVEASNLHLDHRFHSVGPFKDTATVKINVL
DMDEPPVFSKPVYTMEVYEDTPVGTIIGAVTAQDLDAGSSSVRYFMDWKNDVDSYFTIDA
TEGTIATNELLDRESTAQYNFSIIASKVSNPLLTSKVNVIINVLDVNEFPPEISVPYETS
VCENAKPGQVIQTITAADKDLSPAGQRFSFKLSSEASNKPNFTVHDYRNNTAGIETRRNG
YSRRQQELYFLPVVIEDSSYPVQSSTNTLTIRVCRCDSDGTIQSCNVEAIFLPVGLSTGA
LIAILLCIVILLVIVVLYVALRRQKKKDTLMTSKEDIRDNVIHYDDEGGGEEDTQAFDIG
ALRNPKVIEDNKIRRDIKPDTLRFTRHRPPAEDNTDIRDFINQRLKENDVDPSAPPYDSL
ATYAYEGNGSVAESLSSIDSLTTEADQDYDYLSDWGPRFKILADMFGEESYNPDKVT
Download sequence
Identical sequences H0YUL2
ENSTGUP00000001981 ENSTGUP00000001981 59729.ENSTGUP00000001981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]