SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001995 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001995
Domain Number 1 Region: 152-260
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-25
Family Cadherin 0.00035
Further Details:      
 
Domain Number 2 Region: 261-376
Classification Level Classification E-value
Superfamily Cadherin-like 5e-25
Family Cadherin 0.00089
Further Details:      
 
Domain Number 3 Region: 372-492
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-23
Family Cadherin 0.0074
Further Details:      
 
Domain Number 4 Region: 481-589
Classification Level Classification E-value
Superfamily Cadherin-like 5.89e-17
Family Cadherin 0.003
Further Details:      
 
Domain Number 5 Region: 74-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000157
Family Cadherin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001995   Gene: ENSTGUG00000001934   Transcript: ENSTGUT00000002013
Sequence length 789
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:37991395:38092529:-1 gene:ENSTGUG00000001934 transcript:ENSTGUT00000002013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTHSFLRVLLWSSVLYVVHMTPSQKRTNKHSHSERITGLSENDGKTLHRTKRGWMWNQF
FLLEEYTGPDTQYVGKLHTDQDKGDGNLKYILTGDGAGSLFIIDENTGDIHAAKKLDREE
KSLYVLRAKAIDRKTGRQVEPESEFIIKIHDINDNEPKFTKDMYTASIPEMSGVGTSVIQ
VTATDADDANYGNSAKVVYSILQGQPYFSVDPETGIIKTALPDMSRENREQYQVVIQAKD
MGGQMGGLSGTTTVNITLTDVNDNPPRFPQSSYQFSSPESAPPGTPLGRIKANDPDVGEN
AEIEYSISNGDGSDMFDIITDKDTQEGIITVKKHLDFENKVLYTLKVEASNTHPDPRFLQ
LGPFKDTAFVKISVEDIDEPPVFSRPWYLIEVDEDAKEGSIIGRVVAQDPDIAKNAIKYS
VDRHTDLDRIFNIYSGNGSLFLSKPLDREETPWHNITVIATEINNPKQSSQIPVFIRILD
INDHAPEFANYYETFVCENAKAGQLIQTVSAIDKDQPPRGHRFFFELVPEFAVHPNFSVV
DXLDNTAGIMTRRNGYSRSKTSTYLLPIIIFDNDYPIQSSTGTLTIRVCACDSRGNMQSC
SAEALLLPAGLSTGALVAILLCIIILLILVVLFTALKRQRKKEPLIISKDDVRDNIVTYN
DEGGGEEDTQAFDIGTLRNPEAREESKMRRDVIPDTIFQIRRTAPLWENIDVQDFIHRRL
KENDSDPAAPPYDSLATYAYEGNDSIANSLSSLESLTTEGNQDYDYLSDWGPRFKKLADM
YGGEDSDRE
Download sequence
Identical sequences H0YUM6
59729.ENSTGUP00000001995 ENSTGUP00000001995 ENSTGUP00000001995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]