SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002041 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002041
Domain Number 1 Region: 157-265
Classification Level Classification E-value
Superfamily Cadherin-like 1.45e-25
Family Cadherin 0.00037
Further Details:      
 
Domain Number 2 Region: 377-493
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-25
Family Cadherin 0.0049
Further Details:      
 
Domain Number 3 Region: 266-382
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 4 Region: 487-594
Classification Level Classification E-value
Superfamily Cadherin-like 1.17e-19
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 78-164
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000414
Family Cadherin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002041   Gene: ENSTGUG00000001975   Transcript: ENSTGUT00000002059
Sequence length 798
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:40661359:40698539:1 gene:ENSTGUG00000001975 transcript:ENSTGUT00000002059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTSGRMSNAKNLFGLGVSLYFWGLMDLTTTVLSGSARPLTEGQEDNLSDKLHQRMKRSW
VWNQFFVLEEYTGTDPLYVGKLHSDMDRGDGSIKYILSGEGAGIVFTIDDTTGDIHAIQR
LDREERSQYTLRAQALDRRTGRPMEPESEFIIKIQDINDNEPKFLDGPYVASVPEMSPVG
TSVIQVTATDADDPTYGNSARVVYSILQGQPYFSVDSRTGLIRTALMNMDREAKEYYEVI
IQAKDMGGQLGGLAGTTTVNISLSDVNDNPPRFPQKHYQMSVLESAPISSTVGRVVAKDL
DEGINAEMKYSLVDGDGLDVFDINTDPNYQVGIITVRKPLSFESKKSYTLKVEGANPHLE
MRFLNLGPFRDTTTVHISVEDVDEPPVFETSIYFVEVPEDVEIGTTIQIISAKDPDVTNN
SIRYSIDRSSDPGRFFYVDITSGALMTARPLDREDISWHNITVLAMELNNPSQVGSVSVT
VKVLDVNDNAPEFARFYEAFVCENAKAGQLIQTVSAIDRDDPQEGQHFYYSLAPEAANNP
NFTLRDNQDNTAWILTRRSGFRQNEQNTFYLPILISDNGRPVLSSTGTLTVHVCSCDEEG
MVMSCNAEAYVLPVSLSRGALIAILACIFVLLVLVLLILSMRRQRKQPYIIDEEENIHEN
IVRYDDEGGGEEDTEAFDIAAMWNPREAQLVVKNRQDMLPEIESLSRYVPQACVMDNNVH
NYVLAKLYEADMDLWAPPFDSLQTYMFEGNGSVAESLSSLQSVTTDSDQSYDYLTDWGPR
FKKLAEMYGATDSSGALW
Download sequence
Identical sequences H0YUS1
XP_002199261.1.42559 ENSTGUP00000002041 ENSTGUP00000002041 59729.ENSTGUP00000002041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]