SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002061 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002061
Domain Number 1 Region: 245-493
Classification Level Classification E-value
Superfamily Kelch motif 4.97e-35
Family Kelch motif 0.011
Further Details:      
 
Domain Number 2 Region: 426-626
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.83e-18
Family Galactose oxidase, central domain 0.033
Further Details:      
 
Domain Number 3 Region: 4-154
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.48e-17
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002061   Gene: ENSTGUG00000001982   Transcript: ENSTGUT00000002080
Sequence length 733
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:2402391:2498496:-1 gene:ENSTGUG00000001982 transcript:ENSTGUT00000002080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAGPAGAESRVLGYSLHRWGRHFSSTYLPENILVDRPNDQSSRWSSESNYPPQYLILKL
ERPAIVQSITFGKYEKTHVCNLKKFKVFGGMNEENMTDLLSSGLKNDYNKETFTLKHKID
EQMFPCRFIKIVPLLSWGPSFNFSIWYVELNGIDDPDVVQPCLNWYSKYREQEAIRLCLK
HFRQHNYTEAFESLQKKTKIALEHPMLTDLHDKLVLKGDFDACEELIEKAVNDGLFNQYI
SQQEYKPRWGQIIPKSTKGDGEDSRPGMRGGHQMVIDVQTETVYLFGGWDGTQDLADFWA
YSVKENQWTCISRDTEKESGPSARSCHKMCIDIQRRQIYTLGRYLDSSVRNSKSLKSDFY
RYDIDTNTWMLLSEDTAADGGPKLVFDHQMCMDSEKHMIYTFGGRILTCNGSVDDSRASE
PQFSGLFAFDCQCQTWKLLREDSCNAGPEDIQSRIGHCMLFHSKNRCLYVFGGQRSKTYL
NDFFSYDVDSDHVDIISDGTKKDSGMVPMTGFTQRATIDPELNEIHVLSGLSKDKEKREE
NVRNSFWIYDIVRNSWSCVYKNDQAAKENPGKSLQEEEPCPRFAHQLVYDELHKVHYLFG
GNPGKSCSPKMRLDDFWSLKLCRPSKEYLLRHCKYLIRKHRFEEKAQTDPLSALKYLQND
LYVTVDHSDPEETKEFQLLASALFKSGSDFTTLGFSDVDHTYAQRTQLFDTLVNFFPDNM
TPPKGNLVDLITL
Download sequence
Identical sequences H0YUU1
59729.ENSTGUP00000002061 ENSTGUP00000002061 ENSTGUP00000002061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]