SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002066 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002066
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000431
Family Complement control module/SCR domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002066   Gene: ENSTGUG00000002009   Transcript: ENSTGUT00000002085
Sequence length 91
Comment pep:novel chromosome:taeGut3.2.4:1A:2642424:2787855:-1 gene:ENSTGUG00000002009 transcript:ENSTGUT00000002085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGFCGPPKTVPHASIKLPQEHYVGQVLHFKCQSGYDKRPPTFGSRTCKEVNGKTFWTPLD
MRCTNDSNQMLSQLSHLLENMAASRELGHSL
Download sequence
Identical sequences H0YUU6
ENSTGUP00000002066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]