SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002144 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002144
Domain Number 1 Region: 491-680,769-1092
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-70
Family Tandem AAA-ATPase domain 0.026
Further Details:      
 
Domain Number 2 Region: 245-269
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000222
Family CCCH zinc finger 0.0033
Further Details:      
 
Domain Number 3 Region: 109-163
Classification Level Classification E-value
Superfamily UBA-like 0.0000117
Family UBA domain 0.03
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002144
Domain Number - Region: 188-234,291-360
Classification Level Classification E-value
Superfamily UBC-like 0.0797
Family UBC-related 0.03
Further Details:      
 
Domain Number - Region: 185-215
Classification Level Classification E-value
Superfamily UBC-like 0.0934
Family RWD domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002144   Gene: ENSTGUG00000002076   Transcript: ENSTGUT00000002164
Sequence length 1329
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:170954:185129:1 gene:ENSTGUG00000002076 transcript:ENSTGUT00000002164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGSRKCSSKIWDDGDDFCLFEEPRLESRYFCCAPARRGGQMKQRPEAKMPLQTIHMTSEN
QRRVKELLQELQGQELAPESDVAGEDDDEPDYLDDEQCWSTEQEASDVMPRLSAEPAEHR
IVDSEVSSFAVHKLSRYGFDCERCRAVLRSCNGNIGASLEYLLLQCFSERYGEKMQISEA
AAEASQEECLEQRQEEAFALRSIYGEKFIERIKNRVWTFNLELGYLAHRFSKSKQKSTRD
TAKQTSKEICKFYLQGGCRFGSKCRFRHEFPPNHPLNTSKNSADDAHLRCSDGPIYELEV
RFPDENKYPLQAPLVAVYSTDENLPLACRLHIAEFLFGKALAAAESHEPVVYTLVTCLED
EHEISELLSNTHHKFSVPPVSLLAAPPCSRITASSYRALKYPADPQAQSNKVLLSEPQEE
EVVAEEEEEEPEQVVVENESYVNLKKKLSKKYDVQAKSLYNENVKICAQFRQKKSSRHFQ
SMLYERQKLPAWQERENILGLLESHQVLVVSGMTGCGKTTQIPQFILDASLQGSPSRVAN
IICTQPRRISAISVAERVAKERTERIGLTVGYQIRLESVKSSATRLLYCTTGVLLRRLEG
DLTLQGVTHVIVDEVHERTEESDFLLLVLKDIMVQRPDLRIILMSATLNAELFSQYFHSC
PIINIPGRTFPVDQFFLEDVIAMTRYVLEDSSPYRKKVKHEQSGRHKRTAFEEVEEDLRR
AGLLETTDTVVRDSDPDQQLTLKQLLTRYKGVSKSVLKTMSVMDLDKVNLELIEALLEWI
VAGRHSYPPGAVLIFLPGLAEIKMLYEQLQTNALFNNRHSKRCVVYPLHSSLSSEDQQSV
FLRPPAGVTKIIISTNIAETSVTIDDVVYVIDSGKMKEKRYDPSKGMESLEDTFVSKANA
LQRKGRAGRVASGVCFHLFSSHHYNHQLVKQQLPEIQRVPLEQLCLRIKILEMFSEQSLH
SVLSRLIEPPRTESLQASKVRLRDLGALTPEEKLTPLGYHLASLPVDVRIGKLMLFGTIF
RCLDPALTIAASLAFKSPFVSPWDKREEANKKKLEFAVGNSDYLALLQAYKGWRLSIKEG
SQASYNYCRENFLSGRVLQEIASLKRQFAELLSDIGFVKEGLRARDIEKKWSQGGDGVLD
ATGEEANSNAENIKLISAMLCAALYPNVVQVKKPEGKYQKTSTGAVKMQPKAEELKFVTK
NDGYVHIHPSSVNYQTRHFESPYLVYHEKIKTSRVFIRDCSMVSVYPLVLLGGGQVHMQL
LKGDFVISLDDGWIRFVAASHQVAELVKELRCELDQLLQDKIKNPSMDLCMCPRGSRIIG
MIVKLVTTQ
Download sequence
Identical sequences H0YV23
ENSTGUP00000002144 59729.ENSTGUP00000002144 ENSTGUP00000002144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]