SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002149 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002149
Domain Number 1 Region: 221-335
Classification Level Classification E-value
Superfamily Acid proteases 1.88e-27
Family Retroviral protease (retropepsin) 0.018
Further Details:      
 
Domain Number 2 Region: 7-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000276
Family Ubiquitin-related 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002149
Domain Number - Region: 129-181
Classification Level Classification E-value
Superfamily XPC-binding domain 0.0759
Family XPC-binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002149   Gene: ENSTGUG00000002081   Transcript: ENSTGUT00000002169
Sequence length 393
Comment pep:known_by_projection chromosome:taeGut3.2.4:21:272926:285054:-1 gene:ENSTGUG00000002081 transcript:ENSTGUT00000002169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLTVFCLRRDRSEITFNLQVDADFELQNFRALCELESGIPAAESQIVYAERPLTDNNRS
LASYGLKDGDVVILRQKETVEPRPSMRFPGLPRIDFSSIAVPGTSAQQQPPAPAQRPRPS
PPDTPAFPQGLDNPALLREMLLANPHELSLLKERNPPLAEALLSGDLEKFTRVLLEQQQD
RARREQERIRLYSADPFDLEAQAKIEEDIRQQNIEENMTIAMEEAPESFGQVVMLYINCK
VNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQI
EGDFLACSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGSQTSFLPEGELPEC
ARLAYGAGRDDVRPEDIADQELAEAIQKSVEEA
Download sequence
Identical sequences H0YV28
59729.ENSTGUP00000002149 ENSTGUP00000002149 ENSTGUP00000002149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]