SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002177 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002177
Domain Number 1 Region: 123-217
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 2.67e-21
Family Transforming growth factor (TGF)-beta 0.00000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002177   Gene: ENSTGUG00000002113   Transcript: ENSTGUT00000002197
Sequence length 218
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:42393712:42409055:-1 gene:ENSTGUG00000002113 transcript:ENSTGUT00000002197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLWDVVAVCVVLLNTVSTLPLPTGKTPPKGSPSVVEGPEDDLSPISLLPPYAVHSDSNM
PEDYPDQFDEVVDFIQATIKRLRRSPDKQTPIFSRRERNHQNAATNIENSNKKGRRNQKG
KNRGCVLREIHLNVTDLDLGYETKEELIFRYCSGSCDAAETTYDKILKNLTKKKKLVTDK
VRQACCRPIAFDDDLSFLDDNLVYHILKKHSAKRCGCV
Download sequence
Identical sequences H0YV56
XP_002192645.2.42559 ENSTGUP00000002177 ENSTGUP00000002177 59729.ENSTGUP00000002177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]