SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002179 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002179
Domain Number 1 Region: 768-963
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.99e-41
Family Laminin G-like module 0.00053
Further Details:      
 
Domain Number 2 Region: 341-543
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.69e-40
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 561-769
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-38
Family Laminin G-like module 0.00084
Further Details:      
 
Domain Number 4 Region: 4-203
Classification Level Classification E-value
Superfamily Fibronectin type III 4.04e-32
Family Fibronectin type III 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002179   Gene: ENSTGUG00000002114   Transcript: ENSTGUT00000002199
Sequence length 988
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:42587169:42654893:1 gene:ENSTGUG00000002114 transcript:ENSTGUT00000002199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERLGPPLDIRLDSLNCTAFSVQWKMPKQHASTIAGYMVFYSEVEGDKAVKQLSHDVPLSL
DMISMDVVIGDLKPGTPHRVSIGAYGWSGKGRPSMPREVTTXXXXXDKCMPPAPPYQPQI
VVVSDSEVALSWKPGVSEGSSPIQYYTVEFIRPDLDSNWTVIREHIQMESMVLKGLLPNT
RYQFAIRAENSFGSSPASAPSDVIRTFSSEELGSGSYGHRYITDTVTGDGDGFDIDDSDY
DIYIEELRPLPAIKGGNRKFLVETKVTPGSSSRLLSRVLTTTSEPTPSTAAVTRPSTTVR
VATARAARRGSVSSAARLLDLSCDEAVCSADSFCINDYDRGGSRCHCNLGKGGETCEEDI
SIQYPQFSGYSYITFEPLKKSYQTFQITLEFRAESEDGLLLYCGENEHGRGDFMSLAIIR
RSLQFRFNCGTGVGVITSENKIKLGNWHSVTLFRDGVNGWLRMDNNAPVTGKSQGQYSKI
TFQTPFYIGGAPSVYWLVRATGTNRGFQGCVQSLSINGKIIDMRPWPLGKALSGADVGEC
SSGICDEAACINSGTCTASKADSYICLCPLGFKGHHCEEALTLAIPQFNESLRSFASTPW
PLESQNYLSFMEFELTFRPDLETGVILYSYDSDSKDFLSINMVAGYVEFRFDCGSGTAVI
RSEEPVSLGQWHELRVSRTAKNGILQVDKQKPVEGMAEGAFTQIKCSSEIFIGGVPNYDD
VKKNSGILRPFSGSIQKIILNDRTIDVKQDFTFGINLANAAHPCVTSPCANGGTCIPKKD
SYECDCPLGFDGQHCQKAITEAIEIPQFIGRSYLTYDNPDILKRLNRVSGTRTNVFMRFK
TTMKEGLLMWRGNSPMRPNSDFISLGLQEGALIFSYNLGSGIASIMVNGSFSDGRWHRVK
AVRDGQSGKVTVDDYGARTGKSPGKMRQLNINGDLYVGGMKEIALHTNRQYLRGLVGCIS
HLTLSTDYHISLVEDAANGKNINTCGTK
Download sequence
Identical sequences H0YV58
ENSTGUP00000002179 59729.ENSTGUP00000002179 ENSTGUP00000002179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]