SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002242 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002242
Domain Number 1 Region: 145-171,220-462
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.08e-82
Family Eukaryotic proteases 0.00000205
Further Details:      
 
Domain Number 2 Region: 41-102
Classification Level Classification E-value
Superfamily GLA-domain 3.7e-17
Family GLA-domain 0.00043
Further Details:      
 
Domain Number 3 Region: 92-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000503
Family EGF-type module 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002242
Domain Number - Region: 124-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000111
Family EGF-type module 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002242   Gene: ENSTGUG00000002174   Transcript: ENSTGUT00000002262
Sequence length 465
Comment pep:known_by_projection chromosome:taeGut3.2.4:4A:712515:722248:1 gene:ENSTGUG00000002174 transcript:ENSTGUT00000002262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANVPLILSMCLLGACLAAENTVFIGSKEASSVLQRQRRANSNRLEEVIPGNLERECIEE
KCSYEEAREVFENEEKTVSATQMCYGDQCNPNPCKNGAVCKDEINSYVCWCPAGYGKNCE
IDFTCAIKNGGCKHFCSHQPPHKVVCSCAAGYKLHEDGKSCEPTVPFPCGRITAPEAKRK
LTRSMNTFEHWNITGDDPDDGPGEDNATDSSTPAPSRIAPVLRTGTRVVGGSDSMKGEVP
WQVLLVNSEGFGFCGASIINEKWLVTAAHCLKPGYSHNITAVAGEHDTRSHEHTEQLRRV
VRLLPHPTYNASINEYHNDIALLELEQPLTFNSYVTPICLGSREFTNALLKQGVGTVSGW
GKVLFRGRQATTLQVLKVPFVDRPTCLKSTSTSILQNMFCAGFPSGGRDTCEGDSGGPHT
SEIEGTWFLTGITSWGEECALPGKYGIYTRVSKYLKWIKQTTRLP
Download sequence
Identical sequences H0YVC1
ENSTGUP00000002242 59729.ENSTGUP00000002242 ENSTGUP00000002242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]