SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002266 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002266
Domain Number 1 Region: 40-383
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.86e-73
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000285
Further Details:      
 
Domain Number 2 Region: 422-511
Classification Level Classification E-value
Superfamily DUSP-like 0.0000000000000824
Family DUSP, domain in ubiquitin-specific proteases 0.008
Further Details:      
 
Domain Number 3 Region: 905-959
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000184
Family Ubiquitin-related 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002266
Domain Number - Region: 596-644
Classification Level Classification E-value
Superfamily DUSP-like 0.00458
Family DUSP, domain in ubiquitin-specific proteases 0.019
Further Details:      
 
Domain Number - Region: 696-763
Classification Level Classification E-value
Superfamily DUSP-like 0.0051
Family DUSP, domain in ubiquitin-specific proteases 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002266   Gene: ENSTGUG00000002183   Transcript: ENSTGUT00000002286
Sequence length 992
Comment pep:known_by_projection chromosome:taeGut3.2.4:21:505493:532981:-1 gene:ENSTGUG00000002183 transcript:ENSTGUT00000002286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRNCRGNPNCLVGIGEHAWLGEIDENSFHNIDDPNCERRKKNAFVGLTNLGATCYVNTFL
QMWFLNLELRQALYLCPSACGDGVPKDAGAKEADQGHQRAVERGQNLFVSGRGEPGQERK
SPSWVIKGLESSTGGAEDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQKQFCGEYAYVTVC
NQCGRESKLVSKFYELELNIQGHKQLTDCITEFLKEEKLEGDNRYFCETCQSKQNATRKI
RLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIGFSELLDMEPFMEQKNGVYVYELSAVLI
HRGVSAYSGHYIAHVKDPQTGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKC
GKGTHCSRNAYMLVYRLQAREKSLTVQVPAFLQELVERDNCKFEEWCNEMAEMRKQSVAR
GKIKHEEVKELYQRLPAEAGSPYDFISLEWLQKWLDESTPPKPIDNTACLCSHGKLHPDK
ISLMKRISEYVADFFYRRYGGGPRLNVKALCKDCVVERCRILRLKNQLNEDYKTVTNLLK
MTVKGNDGFWVGKASLRSWRQLALEQLNEQDEDAEHSNGKMNGNAQNKDESNEEKREEEE
ELNFNEDIVCPHGDLCISENERRVVSKEAWEKLKQYFPKAPEFPNYKECCSQCKILEREG
EENEALHKMMASEQKTSLQNLFHDKCRPCLGSWPQETDELYIVSQFFVEEWRKFVRRPTR
CSPVSSIANSVLLCPHGGLMFTFASMTKEDSKHIALIWPSEWERIQKLFVVDHVIKITRT
QAAGAGPESARYASEPQLCPECREGLLCQQQRDLREYTQATIYIHKVVDNKKVMKDAAPE
LNVSSSEAEEEREENKPEGEQDPDFNQANGGTKRQKLSHQSYITYQKQGIRRSTRHRKVR
GEKALLVSANQTLKELKIQIMHAFSVPFDQNLSLEGKILSDDTATLGSLGVIPESVILLK
ADEPIADYAAMDDVMQVCMPEEGFKGTGLLGH
Download sequence
Identical sequences H0YVE5
59729.ENSTGUP00000002266 ENSTGUP00000002266 ENSTGUP00000002266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]