SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002273 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002273
Domain Number 1 Region: 554-617
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000756
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 482-528
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000209
Family TSP-1 type 1 repeat 0.00059
Further Details:      
 
Domain Number 3 Region: 23-70
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000183
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 609-666
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000334
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 5 Region: 75-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000336
Family LDL receptor-like module 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002273
Domain Number - Region: 434-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0552
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002273   Gene: ENSTGUG00000002197   Transcript: ENSTGUT00000002293
Sequence length 830
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:43590936:43613124:1 gene:ENSTGUG00000002197 transcript:ENSTGUT00000002293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLRIFLLLEISGFFPIFSSPSSIHCRWNSFGPWSECNGCTQKQIRRRTVAVYGQYGGNPC
PGHALETRPCTPTRGCPTEDGCGDRFRCFSGQCISRSLVCNGDQDCEDDGADEDRCEERK
TVCDIDKTPLNSELTGAGFDIITGETMGRVIHTKSFGGQCRKVFSGDRREYYRLSESILA
YNFQVKVQNDFSYEFFNSTWSYMKHVERYENSNKYKHTENKNLQKFPQGKQLMVVENSVE
VAQFINNHPDFLTLAEPFWKELFNLPVVYEYSIYRRLIEHFGTHFLHSGSLGGHYKVIFY
MDTDKMKAEGVSITDLYKCTSSGWNALIVKKKKKECTKLDELLLTSSGSTGNKIKGDPYI
EGGSPSAVAALSYLDLDNPAGNSRMYTLWAASVTDYPRVIKKKLTPLYELVKEVPCSSVK
KHYLKQAIEEYMAENDPCKCQPCQNGGEAAVEGTQCVCYCKPYTFGAACELGTLVQDQPD
VVDGHWSCWSSWSPCSGGRESRSRTCNNPSPRGGGKACLGEQHESRACEDEELQHLRLIE
PHCFDLSINPTEFCSPPPRLENGFVQNAENAYPVGKNIVYACKHGYSLVGDPVAKCHSNL
QWQVGERYCQETACLLPELEGGLQGEPWKPTYEIGERITLSCPHGTHLEGAHSILCEPSL
KWSPDVKTIQCKRPVPSVRTEVTEPKCQPWEKVYQSQCVCKMPYECGPSLDTCATDQRTK
RHTPLTVCKMHALECMGRKYSLTNAENCKVPQAAEIPCGSCRSWEKCNVPSNICVCDEDR
LCEEGGAQVCAEVSGSAARRTMTECEVGLLRCRGETVILVSIWPCDTQSK
Download sequence
Identical sequences H0YVF2
ENSTGUP00000002273 59729.ENSTGUP00000002273 ENSTGUP00000002273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]