SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002288 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002288
Domain Number 1 Region: 27-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000204
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002288   Gene: ENSTGUG00000002221   Transcript: ENSTGUT00000002308
Sequence length 187
Comment pep:novel chromosome:taeGut3.2.4:3:1034969:1036665:1 gene:ENSTGUG00000002221 transcript:ENSTGUT00000002308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSLLLRSQLEELLGSSVGVEKLQLVSLFVEDVNECQAGLGLCGEGAECFNGVGTYLCRCK
KDYEDHSASESGTLCIRSPRAGVSAFLRHADMLVGAALVAGLVLLVAFSGLCVTALRGQA
PRRSPGPKEPVVRAVEEPAMELHDLGECLRLDPFQLKLRARAPEWLWSVRAHPGQAGGLS
PEQPGPL
Download sequence
Identical sequences H0YVG7
ENSTGUP00000002288 ENSTGUP00000002288 59729.ENSTGUP00000002288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]