SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002291 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002291
Domain Number 1 Region: 644-709
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000124
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 2 Region: 564-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000131
Family TSP-1 type 1 repeat 0.00074
Further Details:      
 
Domain Number 3 Region: 141-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 24-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000379
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 5 Region: 80-127
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000222
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 6 Region: 699-755
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000459
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002291
Domain Number - Region: 518-557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002291   Gene: ENSTGUG00000002207   Transcript: ENSTGUT00000002311
Sequence length 935
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:43628558:43648906:-1 gene:ENSTGUG00000002207 transcript:ENSTGUT00000002311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMTVPMHLVLLSLVIGSSEGCYCEHYPWGSWSACSQSCNFGTQTRHRQIRMDEYYSQNF
CDQLCTKQESRTCNQQTCPINCQLGDFGPWSECDPCVKKQFRSRQLLRPSQFGGQACTEP
LVDSRPCFPAKLCNIVEVDCKNKFRCDSGRCISKTLECNGENDCGDNSDERNCGRKKTVC
NRKYESIPGVQLIGSGFHILTGESRGEVLGNSFNGGQCTIVKRNETRKLYRVPANLEAVS
FQVTDEEDDVTSDFYKDLIPLSDSAYDSSSSTRRDKHSSGIPFLFSRKRRIQVTSSSSFK
KAIEASYEKNSNFIRVHKLISVANFTMKQSDLQLSDIFLKALNHLPLEYNYALYSRIFDD
FGTHYYTSGKMGGSYDILYQYSSEELRNSGLSIEESTECVRTETTRRVFFRKKKKVSTRC
TTNRMTVTHEGSILESAERSVSLVKGGRSEYAAALAWEKKGSFPEHRVFTDWLESTKDNP
VVIDFEVSPIVELVRNVPCAVTKRRHLRRALREHAGTFDPCRCAPCPNNGRPVLSGTACL
CLCPAGTYGANCETRAPGYTSVAVDGRWSCWSEWSPCDASFKKRRTRECNNPSPMNGGKP
CEGQQEEEEDCYVSVFTDRGAPCINDDEAKREENVLIGEPESGCSRPDPPEYGFIRNEKN
QYAVGEEVEIACVSGHSLTGYQYLQCLPDQTWTQQHIECQPSVCLRPPISDSVTISPFKQ
QYNIGETMKLSCQAGFIVTGHTKYTCGKDLSWIPPILRSITCEKDMLTKIRGICSLGQKQ
VGSQCVCMSPEEDCGHYSEDICVLHAATEQNVTKPSCQYSAEMCLGVQSFNFLHAGPCHG
NSNLDWAIERAKLSTNSLKKVPCGYDTCYDWEDCQETQTQCFCLMPYQCPKGEIRPHCIE
METTGRKRTVSHCVLAAMKCAGIKLQVLEQGSCLP
Download sequence
Identical sequences H0YVH0
59729.ENSTGUP00000002291 ENSTGUP00000002291 ENSTGUP00000002291 XP_002193277.2.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]