SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002314 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002314
Domain Number 1 Region: 83-224
Classification Level Classification E-value
Superfamily EF-hand 4.74e-50
Family Osteonectin 0.00000189
Further Details:      
 
Domain Number 2 Region: 29-80
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000277
Family Ovomucoid domain III-like 0.00085
Further Details:      
 
Domain Number 3 Region: 1-25
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family Follistatin (FS) module N-terminal domain, FS-N 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002314   Gene: ENSTGUG00000002242   Transcript: ENSTGUT00000002335
Sequence length 225
Comment pep:novel chromosome:taeGut3.2.4:4:8260517:8263864:1 gene:ENSTGUG00000002242 transcript:ENSTGUT00000002335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTCHNFHCKRGKVCHADKQGEPHCICQDPAACPPTKDYEHVCGTDNKTYDGTCQLFGTKC
QLEGTKTGRQLHLDYMGSCKHIPPCTDYEVDQFPLRMRDWLKNILIQYYERDLNTSGILT
EKQRNKVKTIYQNDKRLVAGDHPVELLLHDFEKNYHMYVYPVHWQFHQLDHHPVDRLLTH
SELAPLRASLVPMEHCITRFFQECDGDQDKLIALKEWCHCFGIKE
Download sequence
Identical sequences H0YVJ3
ENSTGUP00000002314 ENSTGUP00000002314 59729.ENSTGUP00000002314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]