SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002371 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002371
Domain Number 1 Region: 58-264
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-70
Family Calnexin/calreticulin 0.0000000523
Further Details:      
 
Domain Number 2 Region: 265-405
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 7.19e-58
Family P-domain of calnexin/calreticulin 0.000000137
Further Details:      
 
Domain Number 3 Region: 407-452
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000158
Family Calnexin/calreticulin 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002371   Gene: ENSTGUG00000002287   Transcript: ENSTGUT00000002393
Sequence length 502
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:8687561:8701937:-1 gene:ENSTGUG00000002287 transcript:ENSTGUT00000002393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFQWDWLCLGVLIISSVTVGMENKENLDADVEVENFDKQSQEADVDRDKSSLEVVYQTP
KPTGEVYFTETFDEGLSGWVFSVTLKEDTDDNVAKYDGRWEVEELKENALPGDRGLVLKS
VAKYHAISSMLTKAFVFEDKPLIVQYEVNFQKGIDCGGAYIKLLSSSNDLNLEYFFDKTP
YTIMFGPDKCGEDYKLHFIFRHKNPKTGEYDEKHAVRPDVDLKKFYLDKKTHLYTLVLKP
DDTFEILIDQTVVSKGSLLENMIPPVNPSKEIEDPTDQKPDDWDERPKIPDPNAVKPDDW
DEDEPARIEDPDAVKPEGWLDDEPQYVPDPNAKKPKDWDEEMDGEWEAPQIRNAKCETAP
GCGEWVRPMKNNPKYKGKWRAPMIDNPNYQGVWSPRKIPNPDYFEDLDPFKMTAVSAVGL
ELWSMTSDIYFDNFIICSEKEVADRWAADSWGLKKLVASANEPGMFSQLVTAAEEHPWLW
VLYILTLALPIGLSVLFCWPGK
Download sequence
Identical sequences H0YVQ0
ENSTGUP00000002371 ENSTGUP00000002371 59729.ENSTGUP00000002371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]