SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002394 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002394
Domain Number 1 Region: 143-266
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-31
Family Cadherin 0.00091
Further Details:      
 
Domain Number 2 Region: 358-483
Classification Level Classification E-value
Superfamily Cadherin-like 3.66e-29
Family Cadherin 0.002
Further Details:      
 
Domain Number 3 Region: 40-147
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-22
Family Cadherin 0.004
Further Details:      
 
Domain Number 4 Region: 258-362
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-21
Family Cadherin 0.0058
Further Details:      
 
Domain Number 5 Region: 473-579
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-20
Family Cadherin 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002394   Gene: ENSTGUG00000002323   Transcript: ENSTGUT00000002416
Sequence length 1047
Comment pep:known_by_projection chromosome:taeGut3.2.4:4A:924935:978028:1 gene:ENSTGUG00000002323 transcript:ENSTGUT00000002416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KQKIDRDLLCRQSPKCVISLEVMSSSMEICVIKLEIKDLNDNAPSFPTDQIELEISETAS
PGTRVPLESAYDPDSGSFGVQSYEITPNDLFGLETKTRGDGSRFAELVVEKSLDRETQSH
YSYVITALDGGDPPNFGTVELSIRVIDSNDNNPLFEEPAYTVSVPENAPPGTPVIRLNAS
DPDEGTNGQVLYSFHSYVSERARELFQIDPQSGLITVSGAIDYEEGHVYELDVQAKDLGP
NSIPAHCKVTISVQDANDNPPLINLLSVNSELVEVSENAPPGYVIALVRVSDRDSGANGR
VQCKLLGNVPFRLQEYESFSTILVDGRLDREQRDQYNLTIQARDNGIPSLQATKSFTVKI
TDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDPDLGLNGSVSYQIVPSQVRDMPVF
TYVSINPNSGDIYALRSFNHEQTKAFEFKVLAKDGGNPSLQSNATVRVIVLDVNDNTPVI
TAPPLVNGTAEVYIPRNAGVGYLVTVVKADDYDEGENGRLSYEMVEGDRGFFEIDQVNGE
IRTTRAFGENAKTAYELIVVAHDHGKTSLSASALILIYLSPALDAQESIGSVNLSLIFII
ALGSIAAILFVTMIFVAVKCKRDNKEIRTYNCRDGVCQQTQHDVTCMTQKPTWRRGQARW
VSAWECSGAGIAEYSYGHQKKSSKKKKISKNDIRLVPRDVEETDKMNVVSCSSLTSSLNY
FDYHQQTLPLGCRRSESTFLNVESQNSRNAGSNHIYHHTFTGQSPQQPDLIINGMPLPET
ENYSFDSNYVNSRAHLIKSSSTFKDLEGNSLKDSGHEESDQTDSEHDVQRGLYCDTAVND
VLNTSVPSMGSQGPEPGETLLCLGGARCPPQWGRCKLIFTPCPSASPEEILCIKSLSVFA
AAGDEPPARFTGHEPQAFAPFGKEAEPPTEERLANPKGKRTVDSAAYSPKVSGAVREAGN
GCEAVSPVTSPLHLKSPLSGKPAAYGAGHCAGSREREPLGNCGPSRPTEAEPRGADSESS
AQEGNPLLQERCEKDSPGARRLKDIVL
Download sequence
Identical sequences H0YVS3
59729.ENSTGUP00000002394 ENSTGUP00000002394 ENSTGUP00000002394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]