SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002406 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002406
Domain Number 1 Region: 122-364
Classification Level Classification E-value
Superfamily SET domain 3.4e-77
Family Histone lysine methyltransferases 0.00002
Further Details:      
 
Domain Number 2 Region: 24-90
Classification Level Classification E-value
Superfamily Chromo domain-like 2.38e-20
Family Chromo domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002406   Gene: ENSTGUG00000002338   Transcript: ENSTGUT00000002429
Sequence length 401
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:6670739:6677698:1 gene:ENSTGUG00000002338 transcript:ENSTGUT00000002429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AWYVPCLASLETLQELCRKENLTCKSIGITNRNLKSYEVEYLCDYKVEEGKAFYLVKWKG
WPESSNTWEPRKHLNCPLLIQNFLRDRNEYLSRGRGGKAMKLRKHVKTLKPAIADYIVKK
AKQRIALQRWKEELNRKKNHKAMILVENTVDLEGPPLDFYYINEYKPAPGINVLNGITTG
CECDDCPAEKCCPKEAGFILAYNKRKKLKIQPGLPIYECNSYCRCGPDCLNRIVQKGTPY
SLCIFRTNNGRGWGVKTLQKIKTNSFVMEYVGEVITSEEAERRGQFYDNQGNTYLFDLDY
DSDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDLRLPRIALFSTRTIKAGEELTF
DYQMKGSIDLTSDSAEGLTPSKKSIRTVCKCGAMCCRGYLN
Download sequence
Identical sequences H0YVT4
ENSTGUP00000002406 59729.ENSTGUP00000002406 ENSTGUP00000002406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]