SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002415 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002415
Domain Number 1 Region: 115-185
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.75e-17
Family Thyroglobulin type-1 domain 0.0000173
Further Details:      
 
Domain Number 2 Region: 9-49
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000385
Family Growth factor receptor domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002415   Gene: ENSTGUG00000002346   Transcript: ENSTGUT00000002438
Sequence length 185
Comment pep:known_by_projection chromosome:taeGut3.2.4:27:1962739:1971874:1 gene:ENSTGUG00000002346 transcript:ENSTGUT00000002438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCCAASELPRGTAYGVYTARCGAGLRCYPPRGEPRPLRTLMHGQGICTDLADVEAIQESL
QPPEKEEIDHPNNSFSPCSIHDRKCLQKQQAKRVNNGNKMRSSGSPHHREDTRVMAQGSC
QSELHRALERLAASQTRTHEDLYVIPIPNCDRNGNFHPKQCHPALDGQRGKFWCVVRKTG
VKLPG
Download sequence
Identical sequences H0YVU3
ENSTGUP00000002415 ENSTGUP00000002415 59729.ENSTGUP00000002415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]