SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002462 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002462
Domain Number 1 Region: 460-562
Classification Level Classification E-value
Superfamily Cadherin-like 7.46e-31
Family Cadherin 0.00053
Further Details:      
 
Domain Number 2 Region: 558-679
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-31
Family Cadherin 0.0023
Further Details:      
 
Domain Number 3 Region: 237-361
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-30
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 133-241
Classification Level Classification E-value
Superfamily Cadherin-like 7e-23
Family Cadherin 0.0018
Further Details:      
 
Domain Number 5 Region: 666-772
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-19
Family Cadherin 0.0021
Further Details:      
 
Domain Number 6 Region: 348-458
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000186
Family Cadherin 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002462
Domain Number - Region: 32-97
Classification Level Classification E-value
Superfamily Cadherin-like 0.000457
Family Cadherin 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002462   Gene: ENSTGUG00000002396   Transcript: ENSTGUT00000002486
Sequence length 1012
Comment pep:novel chromosome:taeGut3.2.4:4A:2746377:2773320:-1 gene:ENSTGUG00000002396 transcript:ENSTGUT00000002486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLLSGTYLLAVLLACIVFQSGAQEKNYTVREELPENVLIGNLLKDLNLTLDPDVPLSSP
LQFKLVYKTGDVPLVRVEENTGEIFTAANRIDREKLCAGIVSENRCFYEVEVAVLPDEVF
RLVKIRFLIEDINDNAPLFPSTVINISIPENTAINSRYSVPSAIDPDIGVNGIQHYELLK
GQNVFGLDITETPEGDKWPQLIVQQILDREQKDTYVMKIKVEDGGSPPRSSTAILQVTVT
DVNDNRPVFKENDVEVSVPENAPVGTSVSQLHATDADLGSNAQIHFYFSNQISSLAKRLF
AIDNTTGLITIREPLDREESPVHKLTVLASDGSSTPSRATVTVNVTDINDNVPSIDTRYI
INPVNGTVLLSEKAPLNTKIALITVMDKDADQNGKVTCFTDHDVPFRLKPVFDNQFLLET
ATFLDYEATREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTQPIIGLSIPENNA
PGTQLTKISATDADSGRNAEISYILGSDAPPIFNLDRRTGILTAVRKLDREKQDRYSFTV
LAKDNGMPPLQTNATVTVSVLDQNDNSPAFTHNEYNFYVPENLPMYGTVGLITVTDADAG
DNAAVTLSILNGRDNFIIDPLTGVIRPNITFDREQQGSYTFQVKAVDGGRLQRSSTAKVT
INVVDVNDNRPVFVIPSSNYSYELVPTSASPGSVVTKVFAVDNDTGMNAELRYSIIGGNA
RGLFTIDQLTGNITLKEKVIASDHGLHRLVIKVNDLGQPESLYTIALVHLFVNETVTNSS
YVQELVRRNMETPVGQNIGDGEITPQTNDYVKIIIAIIAGTMTVILVIFVTALVRCRQTP
RHKVVQKNKQSGEWVSPNQENRQIKKKKKKKKRSPKSLLLNFVTIEESKPDDPGHEHING
TLDIPVELEEQTMGKYNWATTPTTFKPDSPDLAKHYKSASPQPTFQIKPETPVPPKKHHV
IQELPLDNTFVVGCDSLSKCSSSSSDPYSVSECSCQGGFKTPGPIHTRQVME
Download sequence
Identical sequences H0YVZ0
59729.ENSTGUP00000002462 ENSTGUP00000002462 ENSTGUP00000002462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]