SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002463 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002463
Domain Number 1 Region: 618-816
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.0000000000155
Family Mannose 6-phosphate receptor domain 0.0057
Further Details:      
 
Domain Number 2 Region: 43-73,230-371
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000106
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 3 Region: 540-624
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000014
Family Growth factor receptor domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002463   Gene: ENSTGUG00000002377   Transcript: ENSTGUT00000002487
Sequence length 969
Comment pep:novel chromosome:taeGut3.2.4:1A:6842999:6895425:1 gene:ENSTGUG00000002377 transcript:ENSTGUT00000002487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLQTDYHFEYTECDSSGSRWRVAVPNPSAECSGLPDPVRGKECTFSCASGEYLEMKNQVC
SKCAEGTYSLGSGIKFDEWDELPAGFSNVATFMDTALSSSESKANSCNNSSWTPRGNYIE
SNRDDCTVSLIYAVHLKKSGSVFFEYQYIDNNIFFEFFIQNDQCKEMDSTADKWVKLTDN
GEWGSHSVTLKSGSNILYWRTTGILMGSKVVKPVLVKNITIEGVAYTSECFACKPGTFSD
KPGASGCQVCPRDTYSEKGAKECTKCKEEMYYAEEGSSACIERPPCTSKDFFQIHTPCDK
EGKTQIMYKWIEPKICREDLPDALTLPPSGERQDCPPCNPGFYNNASSSCTPCPPGTFSD
GTQECKACPAGTEPALGFEYKWWNILPGNMKTSCFNVGNSKCDGMNGWEVAGDHIQSGAG
GSDNDYLILNLHIPGFKPPTSVTGATGSELGRITFIFETICSADCVLYFMADVNRKNTNV
VESWERSKERQSYTHIISKNASFTFTWAFQRINEGQDSRQFINDMAKIYSITVTNAVDGV
ASSCRACALGSEQSGSSCVPCPPGHFIEKESSQCKECPANTFLSIHQVYGKEACIPCGPG
SKSTKDHSACFSDCLVSYVKDNQSLNYNFSNLSQVGSLMSGPSFTSRGTKFFHFFNISLC
GNEGKKMAICTDNITDVTLKDMVAESEDFSNFVGAFVCQSTIIPSDSKGFRTALALQSNS
LADRFLGATVETVLENISIKADMFPPSPSKTLDVHFFYKSSTVTTSCENGRATVVTMRCN
PNKPGQGELSVPSSCPAGTCDGCTFYFLWESAEACPLCTEQDYHEIEGACKKGFQETLYV
WNEPKHCIKGVPLPEKRTSPCETVDFWLKVGAGVGAFTAVLLIALTCYFWKKNQKLEYKY
SKLVMTTNSKECELPAADSCAIMEGEDNEEEIVYSNKQSLLGKLKSLATKEKEDNFESVQ
LKSSRSQNI
Download sequence
Identical sequences H0YVZ1
ENSTGUP00000002463 59729.ENSTGUP00000002463 ENSTGUP00000002463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]