SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002469 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002469
Domain Number 1 Region: 5-253
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.65e-81
Family Eukaryotic proteases 0.000000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002469   Gene: ENSTGUG00000002394   Transcript: ENSTGUT00000002493
Sequence length 257
Comment pep:novel chromosome:taeGut3.2.4:21:1036632:1040707:-1 gene:ENSTGUG00000002394 transcript:ENSTGUT00000002493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAFGCGVPAYPPLVSRVVGGENARPYSWPWQASLQYYSNGKWSHTCGGTLIATNWVMTAA
HCISSSMTYRVLLGKYNLAVEEKGAVAIYPQKLIVNKNWNSQNVANGYDIALIKLSQHVT
LSDHIQLACLPPAQSILSSNTACYVTGWGRLQTNGPLPDDLQQGLLRVVDYATCSLPTWW
GSSVKPSMVCAGGDGITSSCSGDSGGPLNCQGADGRWEVHGIVSFGSAISCNQYHKPSVF
TRVSAYISWIEQVRRHR
Download sequence
Identical sequences H0YVZ7
59729.ENSTGUP00000002469 ENSTGUP00000002469 ENSTGUP00000002469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]