SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002496 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002496
Domain Number 1 Region: 93-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000255
Family EGF-type module 0.017
Further Details:      
 
Domain Number 2 Region: 1-29
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000259
Family EGF-type module 0.026
Further Details:      
 
Domain Number 3 Region: 61-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000325
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 125-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000661
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002496
Domain Number - Region: 29-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000628
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002496   Gene: ENSTGUG00000002429   Transcript: ENSTGUT00000002520
Sequence length 155
Comment pep:novel chromosome:taeGut3.2.4:2:46223108:46226072:-1 gene:ENSTGUG00000002429 transcript:ENSTGUT00000002520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQNGGTCLARNLCTCPYGFVGPRCDTMVCNRHCENGGKCLTPDTCQCKPGWYGPTCSTAM
CNPVCLNGGSCTKPDVCLCPHGFFGAHCQNAVCSPPCKNGGHCIRNNVCTCPDGYTGRRC
EKSVCEPRCMNGGRCVGPNICSCPSGWRGKRCNTR
Download sequence
Identical sequences H0YW23
ENSTGUP00000002496 ENSTGUP00000002496 59729.ENSTGUP00000002496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]