SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002520 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002520
Domain Number 1 Region: 24-100
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000345
Family Growth factor receptor domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002520   Gene: ENSTGUG00000002453   Transcript: ENSTGUT00000002544
Sequence length 185
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:47164592:47171113:-1 gene:ENSTGUG00000002453 transcript:ENSTGUT00000002544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFLFLTLLLMPVPAGAAWSAKYAVDCPDPCDSNACKSTARCKRTVLDDCGCCRVCAAA
LGETCYRTVSGMDGVKCGPGLKCQFYTEEDDFGDEFGICKECPYGSYGMECRKACNCPSG
ICDRVTGKCLKFPFFQLSASKPPNRRKISSHTDNDMASGDGNSVKEEFVREKVIRSPVMK
WLNPR
Download sequence
Identical sequences H0YW47
ENSTGUP00000002520 XP_002197463.1.42559 59729.ENSTGUP00000002520 ENSTGUP00000002520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]